Protein Summary

MiaE from Salmonella typhimurium

Full name: tRNA 2-methylthio-N6-isopentenyl adenosine(37) hydroxylase
Synonym:
GI: 312708
Orf: STM4471
COG: COG4445
UniProt: Q08015
Structures: | 2ITB |
Complex:
Enzyme type: hydroxylase
Position of modification - modification: t:37 - ms2io6A

Comments:

This iron-containing hydroxylase catalyzes the posttranscriptional allylic hydroxylation of ms2i6A37 in tRNAs. This enzyme is not present in Escherichia coli.

Protein sequence:

MTVRQRLLSYFFNRLRMNYPQILSPVLNFLHCPTPQAWIVQARDPQNLPL
LLTDHLICELKAAQTALLLVRKYVADKSGADALLSWLQPYEAFAFRQGPE
PDFVALHKQISKSAMPQTDDPWGRQLIDRMVLLIKEELHHFWQVREVMQA
RNIPYVKITASRYAKGMLKAVRTHEPLTLIDKLICGAYIEARSCERFAAL
APWLDEDLQTFYLSLLRSEARHYQDYLALAQQISAEDISARVRYFGEVEA
DLILSPDREFRFHSGVPAAG

Enzymatic activities

Reaction Substrate Type Position
ms2i6A:ms2io6A tRNA (t)   37
i6A:io6A tRNA (t) 37

Publications

Title Authors Journal Details PubMed Id DOI
tRNA-modifying MiaE protein from Salmonella typhimurium is a nonheme diiron monooxygenase. Mathevon C, Pierrel F, Oddou JL, Garcia-Serres R, Blondin G, Latour JM, Menage S, Gambarelli S, Fontecave M, Atta M Proc Natl Acad Sci U S A [details] 17679698 -
Structural bioinformatics analysis of enzymes involved in the biosynthesis pathway of the hypermodified nucleoside ms(2)io(6)A37 in tRNA. Kaminska KH, Baraniak U, Boniecki M, Nowaczyk K, Czerwoniec A, Bujnicki JM Proteins [details] 17910062 -
Isolation of the gene (miaE) encoding the hydroxylase involved in the synthesis of 2-methylthio-cis-ribozeatin in tRNA of Salmonella typhimurium and characterization of mutants. Persson BC, Bjork GR J Bacteriol [details] 8253666 -
The ms2io6A37 modification of tRNA in Salmonella typhimurium regulates growth on citric acid cycle intermediates. Persson BC, Olafsson O, Lundgren HK, Hederstedt L, Bjork GR J Bacteriol [details] 9620964 -

Links

_PubMed_

Last modification of this entry: 2012-11-30 14:17:01.352062
Edited by a user: magda
Edited content: Changed additional_information.