Protein Summary

TrmK from Bacillus subtilis

Full name: tRNA (adenine(22)-N(1))-methyltransferase
Synonym:
GI: 332278123
Orf: YqfN
COG:
UniProt: P54471
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:22 - m1A

Comments:



Protein sequence:

MADIGSDHAYLPCYAVLNHKASGAIAGEITDGPFLSAKRQVEKSGLNSHI
SVRQGDGLEVIKKGEADAITIAGMGGALIAHILEAGKDKLTGKERLILQP
NIHAVHIREWLYKERYALIDEVILEEDGKCYEVLVAEAGDRDAAYDGISL
SAGMLVGPFLAKEKNAVFLKKWTQELQHTQSIYEQISQAADTEQNKQKLK
ELADRMELLKEVIDHG

Enzymatic activities

Reaction Substrate Type Position
A:m1A tRNA (t)   22

Publications

Title Authors Journal Details PubMed Id DOI
The YqfN protein of Bacillus subtilis is the tRNA: m1A22 methyltransferase (TrmK). Roovers M, Kaminska KH, Tkaczuk KL, Gigot D, Droogmans L, Bujnicki JM Nucleic Acids Res [details] 18420655 -

Last modification of this entry: 2015-07-22 10:27:22.425342
Edited by a user: magda
Edited content: Changed position.