Protein Summary

Ceg1 from Saccharomyces cerevisiae

Full name: GTP-RNA guanylyltransferase
Synonym: GTase, Mce1
GI: 1322697
Orf: CEG1
COG: COG5226
UniProt: Q01159
Structures: | 3KYH |
Complex:
Enzyme type: guanylyltransferase
Position of modification - modification: m:0 - m7Gpp(pN)

Comments:

The yeast capping enzyme (Ceg1p/Cet1p) represses RNA polymerase II transcription in vivo, suggesting a bidirectional flow of information between capping and transcription

Protein sequence:

MVLAMESRVAPEIPGLIQPGNVTQDLKMMVCKLLNSPKPTKTFPGSQPVS
FQHSDVEEKLLAHDYYVCEKTDGLRVLMFIVINPVTGEQGCFMIDRENNY
YLVNGFRFPRLPQKKKEELLETLQDGTLLDGELVIQTNPMTKLQELRYLM
FDCLAINGRCLTQSPTSSRLAHLGKEFFKPYFDLRAAYPNRCTTFPFKIS
MKHMDFSYQLVKVAKSLDKLPHLSDGLIFTPVKAPYTAGGKDSLLLKWKP
EQENTVDFKLILDIPMVEDPSLPKDDRNRWYYNYDVKPVFSLYVWQGGAD
VNSRLKHFDQPFDRKEFEILERTYRKFAELSVSDEEWQNLKNLEQPLNGR
IVECAKNQETGAWEMLRFRDDKLNGNHTSVVQKVLESINDSVSLEDLEEI
VGDIKRCWDERRANMAGGSGRPLPSQSQNATLSTSKPVHSQPPSNDKEPK
YVDEDDWSD

Enzymatic activities

Reaction Substrate Type Position
p(pN):Gpp(pN) mRNA (m) 0

Publications

Title Authors Journal Details PubMed Id DOI
mRNA capping enzyme. Isolation and characterization of the gene encoding mRNA guanylytransferase subunit from Saccharomyces cerevisiae. Shibagaki Y, Itoh N, Yamada H, Nagata S, Mizumoto K J Biol Chem [details] 1315757 -
Isolation of temperature-sensitive mutants for mRNA capping enzyme in Saccharomyces cerevisiae. Yamagishi M, Mizumoto K, Ishihama A Mol Gen Genet [details] 7500935 -
Messenger RNA guanylyltransferase from Saccharomyces cerevisiae. Large scale purification, subunit functions, and subcellular localization. Itoh N, Yamada H, Kaziro Y, Mizumoto K J Biol Chem [details] 3029058 -
Structure of the Saccharomyces cerevisiae Cet1-Ceg1 mRNA capping apparatus. Gu M, Rajashankar KR, Lima CD Structure [details] 20159466 -
An essential function of Saccharomyces cerevisiae RNA triphosphatase Cet1 is to stabilize RNA guanylyltransferase Ceg1 against thermal inactivation. Hausmann S, Ho CK, Schwer B, Shuman S... J Biol Chem [details] 11463793 -

Links

_PubMed_
_Wikipedia_

Last modification of this entry: 2012-08-31 12:50:59.000470
Edited by a user: magda
Edited content: Changed additional_information and papers.