Protein Summary

ThiI from Escherichia coli

Full name: tRNA 4-thiouridine(8) synthase
Synonym: NuvA
GI: 2501549
Orf: b0423
COG: COG0301
UniProt: P77718
Complex:
Enzyme type: sulfurtransferase
Position of modification - modification: t:8 - s4U

Comments:

Requires IcsS as a sulphur donor. Thiamine biosyntheses protein. Contains 1 rhodanese domain. Sulfur is transferred to ThiI through direct binding of IscS. ThiI then transfers the sulfur group to the conserved U8 of bacterial tRNA to form s4U8.

Protein sequence:

MKFIIKLFPEITIKSQSVRLRFIKILTGNIRNVLKHYDETLAVVRHWDNI
EVRAKDENQRLAIRDALTRIPGIHHILEVEDVPFTDMHDIFEKALVQYRD
QLEGKTFCVRVKRRGKHDFSSIDVERYVGGGLNQHIESARVKLTNPDVTV
HLEVEDDRLLLIKGRYEGIGGFPIGTQEDVLSLISGGFDSGVSSYMLMRR
GCRVHYCFFNLGGAAHEIGVRQVAHYLWNRFGSSHRVRFVAINFEPVVGE
ILEKIDDGQMGVILKRMMVRAASKVAERYGVQALVTGEALGQVSSQTLTN
LRLIDNVSDTLILRPLISYDKEHIINLARQIGTEDFARTMPEYCGVISKS
PTVKAVKSKIEAEEEKFDFSILDKVVEEANNVDIREIAQQTEQEVVEVET
VNGFGPNDVILDIRSIDEQEDKPLKVEGIDVVSLPFYKLSTKFGDLDQNK
TWLLWCERGVMSRLQALYLREQGFNNVKVYRP

Enzymatic activities

Reaction Substrate Type Position
U:s4U tRNA (t) Arg/ICG/prokaryotic cytosol 8
U:s4U tRNA (t) Asn/QUU/prokaryotic cytosol 8
U:s4U tRNA (t) Asp/QUC/prokaryotic cytosol 8
U:s4U tRNA (t) Cys/GCA/prokaryotic cytosol 8
U:s4U tRNA (t) Gln/NUG/prokaryotic cytosol 8
U:s4U tRNA (t) Gln/CUG/prokaryotic cytosol 8
U:s4U tRNA (t) Gly/CCC/prokaryotic cytosol 8
U:s4U tRNA (t) His/QUG/prokaryotic cytosol 8
U:s4U tRNA (t) Ile/}AU/prokaryotic cytosol 8
U:s4U tRNA (t) Leu/)AA/prokaryotic cytosol 8
U:s4U tRNA (t) Met/MAU/prokaryotic cytosol 8
U:s4U tRNA (t) Phe/GAA/prokaryotic cytosol 8
U:s4U tRNA (t) Ser/UGA/prokaryotic cytosol 8
U:s4U tRNA (t) Ser/GCU/prokaryotic cytosol 8
U:s4U tRNA (t) Ser/GGA/prokaryotic cytosol 8
U:s4U tRNA (t) Trp/CCA/prokaryotic cytosol 8
U:s4U tRNA (t) Tyr/QUA/prokaryotic cytosol 8
U:s4U tRNA (t) Val/VAC/prokaryotic cytosol 8
U:s4U tRNA (t) Val/GAC/prokaryotic cytosol 8
U:s4U tRNA (t)   8
U:s4U tRNA (t)   8
U:s4U tRNA (t)   8
U:s4U tRNA (t) Leu/BAA/prokaryotic cytosol 8

Publications

Title Authors Journal Details PubMed Id DOI
Identification of a gene involved in the generation of 4-thiouridine in tRNA. Mueller EG, Buck CJ, Palenchar PM, Barnhart LE, Paulson JL Nucleic Acids Res [details] 9592144 -
Evidence for the transfer of sulfane sulfur from IscS to ThiI during the in vitro biosynthesis of 4-thiouridine in Escherichia coli tRNA. Kambampati R, Lauhon CT J Biol Chem [details] 10753862 -
Deduced RNA binding mechanism of ThiI based on structural and binding analyses of a minimal RNA ligand. Tanaka Y, Yamagata S, Kitago Y, Yamada Y, Chimnaronk S, Yao M, Tanaka I RNA [details] 19509301 -
Direct evidence that ThiI is an ATP pyrophosphatase for the adenylation of uridine in 4-thiouridine biosynthesis. You D, Xu T, Yao F, Zhou X, Deng Z Chembiochem [details] 18604845 -
Direct evidence for enzyme persulfide and disulfide intermediates during 4-thiouridine biosynthesis. Wright CM, Christman GD, Snellinger AM, Johnston MV, Mueller EG Chem Commun (Camb) [details] 16855700 -

Links

_MetaCyc_

Last modification of this entry: 2012-07-04 13:18:51.628302
Edited by a user: magda
Edited content: Changed protein_sequence, if_enzyme, nomenclature, catalytic_domain_fold and comments.