Protein Summary

RlmB from Escherichia coli

Full name: Ribosomal RNA large subunit methyltransferase B
Synonym: YjfH, JW4138
GI: 52783780
Orf: b4180
COG: COG0566
UniProt: P63177
Structures: | 1GZ0 |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: l:2251(2251) - Gm

Comments:

RlmB is a SPOUT-type of methyltransferase catalyzing formation of Gm at the conserved position 2251 in the peptidyltransferase domain V of large subunit rRNA (hairpin 80, also named P-loop). The ortholog SPOUT enzyme in S. cerevisiae is Mrm1 (formerly Pet56) catalyzing Gm at equivalent position 2270 (S. cerevisiae numbering) in large subunit mitochondrial rRNA. In cytoplasmic rRNA, the same conserved Gm is catalyzed at position 2619 (S. cerevisiae numbering) by C/D box RNP, guided by snR67. AdoMet is the donor of methyl group. The N-terminal domain of E. coli RlmB is similar to those in ribosomal proteins L7 and L30.

Protein sequence:

MSEMIYGIHAVQALLERAPERFQEVFILKGREDKRLLPLIHALESQGVVI
QLANRQYLDEKSDGAVHQGIIARVKPGRQYQENDLPDLIASLDQPFLLIL
DGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATAKKVACGAAESVP
LIRVTNLARTMRMLQEENIWIVGTAGEADHTLYQSKMTGRLALVMGAEGE
GMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVRQRS

Enzymatic activities

Reaction Substrate Type Position
G:Gm rRNA (r) LSU/23S/prokaryotic cytosol 2251

Publications

Title Authors Journal Details PubMed Id DOI
The structure of the RlmB 23S rRNA methyltransferase reveals a new methyltransferase fold with a unique knot. Michel G, Sauve V, Larocque R, Li Y, Matte A, Cygler M Structure [details] 12377117 -
The rlmB gene is essential for formation of Gm2251 in 23S rRNA but not for ribosome maturation in Escherichia coli. Lovgren JM, Wikstrom PM J Bacteriol [details] 11698387 -

Last modification of this entry: 2012-07-04 12:28:59.385587
Edited by a user: magda
Edited content: Changed protein_sequence, if_enzyme, nomenclature, catalytic_domain_fold and comments.