Protein Summary

Mss1 from Saccharomyces cerevisiae

Full name: tRNA modification GTPase MSS1
Synonym: Pet53
GI: 1709142
Orf: YMR023C
COG: COG0486
UniProt: P32559
Complex: Mss1/Mto1
Enzyme type: GTPase
Position of modification - modification:

Comments:

Yeast mitochondrial homolog of bacterial GTPase MnmE. Makes a stable complex with Mto1p. Does not work on cytoplasmic tRNAs.

Protein sequence:

MNSASFLQSRLISRSFLVRRSLKRYSGLAKPYTFQQPTIYALSTPANQTS
AIAIIRISGTHAKYIYNRLVDSSTVPPIRKAILRNIYSPSSCSVKPHDQK
ESKILLDTSLLLYFQAPYSFTGEDVLELHVHGGKAVVNSILKAIGSLHDR
SSGKDIRFALPGDFSRRAFQNGKFDLTQLEGIKDLIDSETESQRRSALSS
FNGDNKILFENWRETIIENMAQLTAIIDFADDNSQEIQNTDEIFHNVEKN
IICLRDQIVTFMQKVEKSTILQNGIKLVLLGAPNVGKSSLVNSLTNDDIS
IVSDIPGTTRDSIDAMINVNGYKVIICDTAGIREKSSDKIEMLGIDRAKK
KSVQSDLCLFIVDPTDLSKLLPEDILAHLSSKTFGNKRIIIVVNKSDLVS
DDEMTKVLNKLQTRLGSKYPILSVSCKTKEGIESLISTLTSNFESLSQSS
ADASPVIVSKRVSEILKNDVLYGLEEFFKSKDFHNDIVLATENLRYASDG
IAKITGQAIGIEEILDSVFSKFCIGK

Enzymatic activities

Reaction Substrate Type Position
s2U:cmnm5s2U tRNA (t)   34
U:cmnm5U tRNA (t) 34

Publications

Title Authors Journal Details PubMed Id DOI
MSS1, a nuclear-encoded mitochondrial GTPase involved in the expression of COX1 subunit of cytochrome c oxidase. Decoster E, Vassal A, Faye G J Mol Biol [details] 8392589 -
Mitochondria-specific RNA-modifying enzymes responsible for the biosynthesis of the wobble base in mitochondrial tRNAs. Implications for the molecular pathogenesis of human mitochondrial diseases. Umeda N, Suzuki T, Yukawa M, Ohya Y, Shindo H, Watanabe K, Suzuki T J Biol Chem [details] 15509579 -

Links

_PubMed_
_SGD_

Last modification of this entry: 2012-11-30 14:50:49.203103
Edited by a user: magda
Edited content: Changed comments.