Protein Summary

Tgs1 from Saccharomyces cerevisiae

Full name: Trimethylguanosine synthase 1
Synonym: P2573
GI: 74583797
Orf: YPL157W
COG: COG0116
UniProt: Q12052
Complex:
Enzyme type: methyltransferase
Position of modification - modification: snoRNA:0 - m2,2,7Gpp(pN)
n:0 - m2,2,7Gpp(pN)

Comments:

AdoMet is the methyl group donor. Carries out N2-dimethylation of m7G cap in snRNA and snoRNA. Involved in telomere regulation; m3G cap formation of the telomerase RNA TLC1 depends on Tgs1.

Protein sequence:

MGRTFIHASKIKHAARKRKHHSNFRTLIKLLNNDAYKIESSKPLKNGKLF
KYWKNRRRLFSKIDSASIYMTDELWFSVTPERIACFLANFVKACMPNAER
ILDVFCGGGGNTIQFAMQFPYVYGVDYSIEHIYCTAKNAQSYGVDDRIWL
KRGSWKKLVSKQKLSKIKYDCVFGSPPWGGPEYLRNDVYDLEQHLKPMGI
TKMLKSFLKLSPNVIMFLPRNSDLNQLSRATRKVLGPFAKCKVLYVKENG
YMKGIFCMWGECFFNYEPASTENSRRESSEKEELSSENEELSKRKKHEST
TTTKDNTVDIYDVNG

Enzymatic activities

Reaction Substrate Type Position
m7G:m2,7G snoRNA (sno)   1
m2,7G:m2,2,7G snoRNA (sno)   1
m7G:m2,7G snRNA (sn)   1
m2,7G:m2,2,7G snRNA (sn)   1

Publications

Title Authors Journal Details PubMed Id DOI
Specificity and mechanism of RNA cap guanine-N2 methyltransferase (Tgs1). Hausmann S, Shuman S J Biol Chem [details] 15590684 -
Hypermethylation of the cap structure of both yeast snRNAs and snoRNAs requires a conserved methyltransferase that is localized to the nucleolus. Mouaikel J, Verheggen C, Bertrand E, Tazi J, Bordonne R Mol Cell [details] 11983179 -
Sequence-structure-function relationships of Tgs1, the yeast snRNA/snoRNA cap hypermethylase. Mouaikel J, Bujnicki JM, Tazi J, Bordonne R Nucleic Acids Res [details] 12907733 -
Hypermethylation of yeast telomerase RNA by the snRNA and snoRNA methyltransferase Tgs1. Franke J, Gehlen J, Ehrenhofer-Murray AE J Cell Sci [details] 18840651 -

Last modification of this entry: 2012-07-04 13:15:19.164095
Edited by a user: magda
Edited content: Changed protein_sequence, if_enzyme, nomenclature and comments.