Protein Summary

TrmB from Escherichia coli

Full name: tRNA (guanine(46)-N7)-methyltransferase
Synonym: YggH
GI: 67473592
Orf: b2960
COG: COG0220
UniProt: P0A8I5
Structures: | 3DXX | 3DXY | 3DXZ |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:46 - m7G

Comments:

AdoMet is the methyl group donor.

Protein sequence:

MKNDVISPEFDENGRPLRRIRSFVRRQGRLTKGQEHALENYWPVMGVEFS
EDMLDFPALFGREAPVTLEIGFGMGASLVAMAKDRPEQDFLGIEVHSPGV
GACLASAHEEGLSNLRVMCHDAVEVLHKMIPDNSLRMVQLFFPDPWHKAR
HNKRRIVQVPFAELVKSKLQLGGVFHMATDWEPYAEHMLEVMSSIDGYKN
LSESNDYVPRPASRPVTKFEQRGHRLGHGVWDLMFERVK

Enzymatic activities

Reaction Substrate Type Position
G:m7G tRNA (t) Ala/UGC/prokaryotic cytosol 46
G:m7G tRNA (t) Ala/GGC/prokaryotic cytosol 46
G:m7G tRNA (t) Arg/ACG/prokaryotic cytosol 46
G:m7G tRNA (t) Arg/CCG/prokaryotic cytosol 46
G:m7G tRNA (t) Asn/GUU/prokaryotic cytosol 46
G:m7G tRNA (t) Asp/GUC/prokaryotic cytosol 46
G:m7G tRNA (t) Gly/GCC/prokaryotic cytosol 46
G:m7G tRNA (t) His/GUG/prokaryotic cytosol 46
G:m7G tRNA (t) Ile/GAU/prokaryotic cytosol 46
G:m7G tRNA (t) Ile/CAU/prokaryotic cytosol 46
G:m7G tRNA (t) Lys/SUU/prokaryotic cytosol 46
G:m7G tRNA (t) Met/CAU/prokaryotic cytosol 46
G:m7G tRNA (t) Phe/GAA/prokaryotic cytosol 46
G:m7G tRNA (t) Thr/GGU/prokaryotic cytosol 46
G:m7G tRNA (t) Trp/CCA/prokaryotic cytosol 46
G:m7G tRNA (t) Val/UAC/prokaryotic cytosol 46
G:m7G tRNA (t) Val/GAC/prokaryotic cytosol 46
G:m7G tRNA (t)   46

Publications

Title Authors Journal Details PubMed Id DOI
The yggH gene of Escherichia coli encodes a tRNA (m7G46) methyltransferase. De Bie LG, Roovers M, Oudjama Y, Wattiez R, Tricot C, Stalon V, Droogmans L, Bujnicki JM J Bacteriol [details] 12730187 -
Sequence-structure-function relationships of a tRNA (m7G46) methyltransferase studied by homology modeling and site-directed mutagenesis. Purta E, van Vliet F, Tricot C, De Bie LG, Feder M, Skowronek K, Droogmans L, Bujnicki JM Proteins [details] 15789416 -

Last modification of this entry: 2012-07-04 13:29:31.594902
Edited by a user: magda
Edited content: Changed protein_sequence, if_enzyme, nomenclature, catalytic_domain_fold and comments.