Protein Summary

Tgs2 from Giardia lamblia

Full name: RNA cap guanine-N2 methyltransferase
Synonym:
GI: 159108485
Orf: GL50803_5613
COG: COG2265
UniProt: A8BW33
Complex:
Enzyme type: methyltransferase
Position of modification - modification: snoRNA:0 - m2,2,7Gpp(pN)
n:0 - m2,2,7Gpp(pN)

Comments:

Tgs2 is an AdoMet and m7G-dependent methyltransferase.

Protein sequence:

MSTWLLDSKCVERMKWLFSDLPEEKRVMIKMNEVAFFSVTPAVYADEVAR
MMRTVLALLGKPPYAVIDGTACVGGDTRLLAKHFDMTVAIERDPETYALL
QDNLTTWGVDAKTISGDTAALIPQFWTLIGAVATFSLYLDPPWGGVDYRS
QTDIQLTLGSLAVEDVVNRAFEAHLSMKLAVLKLPRNYNCGYLFRKLGKH
EVFRITQGNFFVFFVARRGSRVKEHGRTAMLQLRKAREEAKARSEETKED
GETRGSGE

Enzymatic activities

Reaction Substrate Type Position
m7G:m2,7G snoRNA (sno)   1
m7G:m2,7G snRNA (sn)   1

Publications

Title Authors Journal Details PubMed Id DOI
Giardia lamblia RNA cap guanine-N2 methyltransferase (Tgs2). Hausmann S, Shuman S J Biol Chem [details] 16046409 -
Biochemical and genetic analysis of RNA cap guanine-N2 methyltransferases from Giardia lamblia and Schizosaccharomyces pombe. Hausmann S, Ramirez A, Schneider S, Schwer B, Shuman S Nucleic Acids Res [details] 17284461 -

Last modification of this entry: 2014-01-23 11:20:34.880250
Edited by a user: magda
Edited content: Changed swiss.