Protein Summary

Trm8 from Saccharomyces cerevisiae

Full name: tRNA (guanine-N(7)-)-methyltransferase
Synonym:
GI: 32171782
Orf: YDL201W
COG: COG0220
UniProt: Q12009
Structures: | 2VDU | 2VDV |
Complex: Trm8/Trm82
Enzyme type: methyltransferase
Position of modification - modification: t:46 - m7G

Comments:

AdoMet is the methyl group donor. Heterodimer composed of two unrelated subunits: Trm8p (catalytic subunit) and Trm82p (cofactor, stimulates the activity of Trm8p, but is NOT absolutely essential). Works with Trm82p. Trm8p/Trm82p are not structuraly related. Belongs to the methyltransferase superfamily. TrmB family.

Protein sequence:

MKAKPLSQDPGSKRYAYRINKEENRKELKHVKINESSLVQEGQKIDLPKK
RYYRQRAHSNPFSDHQLEYPVSPQDMDWSKLYPYYKNAENGQMTKKVTIA
DIGCGFGGLMIDLSPAFPEDLILGMEIRVQVTNYVEDRIIALRNNTASKH
GFQNINVLRGNAMKFLPNFFEKGQLSKMFFCFPDPHFKQRKHKARIITNT
LLSEYAYVLKEGGVVYTITDVKDLHEWMVKHLEEHPLFERLSKEWEENDE
CVKIMRNATEEGKKVERKKGDKFVACFTRLPTPAIL

Enzymatic activities

Reaction Substrate Type Position
G:m7G tRNA (t) Cys/GCA/prokaryotic cytosol 46
G:m7G tRNA (t) Ile/UAU/prokaryotic cytosol 46
G:m7G tRNA (t) Lys/CUU/prokaryotic cytosol 46
G:m7G tRNA (t) Lys/SUU/prokaryotic cytosol 46
G:m7G tRNA (t) Met/CAU/prokaryotic cytosol 46
G:m7G tRNA (t) Phe/GAA/prokaryotic cytosol 46
G:m7G tRNA (t) Pro/UGG/prokaryotic cytosol 46
G:m7G tRNA (t) Trp/CCA/prokaryotic cytosol 46
G:m7G tRNA (t) Val/CAC/prokaryotic cytosol 46
G:m7G tRNA (t) Val/IAC/prokaryotic cytosol 46
G:m7G tRNA (t)   46

Publications

Title Authors Journal Details PubMed Id DOI
Two proteins that form a complex are required for 7-methylguanosine modification of yeast tRNA. Alexandrov A, Martzen MR, Phizicky EM RNA [details] 12403464 -
Structure of the yeast tRNA m7G methylation complex. Leulliot N, Chaillet M, Durand D, Ulryck N, Blondeau K, van Tilbeurgh H Structure [details] 18184583 -

Last modification of this entry: 2012-07-04 13:28:04.456598
Edited by a user: magda
Edited content: Changed protein_sequence, if_enzyme, nomenclature and comments.