Protein Summary

Trm9 from Saccharomyces cerevisiae

Full name: tRNA (uracil-5-)-methyltransferase TRM9
Synonym: YM9571.04
GI: 1730616
Orf: YML014W
COG: COG2226
UniProt: P49957
Structures: | 5CM2 |
Complex: Trm9/Trm112
Enzyme type: methyltransferase
Position of modification - modification: t:34 - mcm5s2U
t:34 - mcm5U

Comments:

Works with NFS1.?

Protein sequence:

MEINQAAEKEQEYVHKVYNEIAPHFSQTRYKPWPIVTQFLKTRPMGSIGI
DVGCGNGKYLGVNPDIYIIGSDRSDGLIECARGINPSYNLLVADGLNLPH
KNETFDFAISIAVVHHWSTRERRVEVIRHVLSKLRQGGQALIYCWALEQG
SSRRGYHEGMEQDVFVPWVLPKSKSKPKTKSTPPAKVKTRPKPNLMNIPP
KERSEYLQRWKEEQQRSKSLDDNDEKQQQDQEQEREEVKYRYYHLYREGE
LAEDCRQAGAAVHSEGFERDNWWVVAQKR

Enzymatic activities

Reaction Substrate Type Position
cm5U:mcm5U tRNA (t) Arg/UCU/prokaryotic cytosol 34
cm5s2U:mcm5s2U tRNA (t)   34

Publications

Title Authors Journal Details PubMed Id DOI
Novel methyltransferase for modified uridine residues at the wobble position of tRNA. Kalhor HR, Clarke S Mol Cell Biol [details] 14645538 -
Insights into molecular plasticity in protein complexes from Trm9-Trm112 tRNA modifying enzyme crystal structure. Letoquart J, Tran NV, Caroline V, Aleksandrov A, Lazar N, van Tilbeurgh H, Liger D, Graille M... Nucleic Acids Res [details] 26438534 -
Translational infidelity-induced protein stress results from a deficiency in Trm9-catalyzed tRNA modifications. Patil A, Chan CT, Dyavaiah M, Rooney JP, Dedon PC, Begley TJ. RNA Biol. [details] 22832247 10.4161/rna.20531
Trm9-Catalyzed tRNA Modifications Regulate Global Protein Expression by Codon-Biased Translation Deng W, Babu IR, Su D, Yin S, Begley TJ, Dedon PC PLoS Genet. [details] 26670883 10.1371/journal.pgen.1005706

Last modification of this entry: 2017-09-14 16:39:26.505687
Edited by a user: elapurta
Edited content: Changed papers.