Protein Summary

TrmR from Bacillus subtilis

Full name: tRNA mo5U methyltransferase
Synonym: yrrM, putative acyl-CoA O-methyltransferase
GI: None
Orf:
COG:
UniProt: O32036
Structures: | 5ZW3 |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:34 - mo5U

Comments:



Protein sequence:

MTDRYEQINDYIEALLKPRPDNVKRLEAYAEEHHVPIMEKAGMEVLLQIL
SVKQPKKILEIGTAIGYSAIRMALELPSAEIYTIERNEKRHEEAVNNIKE
FQLDDRIHVFYGDALELADAVHVTAPYDVIFIDAAKGQYQNFFHLYEPML
SPDGVIITDNVLFKGLVAEDYSKIEPKRRRRLVAKIDEYNHWLMNHPDYQ
TAIIPVGDGLAISKKKR

Enzymatic activities

Reaction Substrate Type Position
ho5U:mo5U tRNA (t) many 34

Publications

Title Authors Journal Details PubMed Id DOI
Identification of a novel tRNA wobble uridine modifying activity in the biosynthesis of 5-methoxyuridine. Ryu H, Grove TL, Almo SC, Kim J... Nucleic Acids Res [details] 29982645 -

Last modification of this entry: 2019-05-28 11:40:19.952131
Edited by a user: boccaletto
Edited content: Changed pdb_id.