Protein Summary

CDKAL1 from Homo sapiens

Full name: CDK5 regulatory subunit associated protein 1 like 1
Synonym: FLJ20342
GI: None
Orf:
COG:
UniProt:
Structures: | Q5VV42 |
Complex:
Enzyme type: threonylcarbamoyladenosine synthetase
Position of modification - modification:

Comments:



Protein sequence:

>SP|QVV|CDKAL_HUMANTHREONYLCARBAMOYLADENOSINETRNAM
ETHYLTHIOTRANSFERASEOS=HOMOSAPIENSOX=GN=CDKALPE=SV
=MPSASCDTLLDDIEDIVSQEDSKPQDRHFVRKDVVPKVRRRNTQKYLQE
EENSPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAAYGYKITENAS
DADLWLLNSCTVKNPAEDHFRNSIKKAQEENKKIVLAGCVPQAQPRQDYL
KGLSIIGVQQIDRVVEVVEETIKGHSVRLLGQKKDNGRRLGGARLDLPKI
RKNPLIEIISINTGCLNACTYCKTKHARGNLASYPIDELVDRAKQSFQEG
VCEIWLTSEDTGAYGRDIGTNLPTLLWKLVEVIPEGAMLRLGMTNPPYIL
EHLEEMAKILNHPRVYAFLHIPVQSASDSVLMEMKREYCVADFKRVVDFL
KEKVPGITIATDIICGFPGETDQDFQETVKLVEEYKFPSLFINQFYPRPG
TPAAKMEQVPAQVKKQRTKDLSRVFHSYSPYDHKIGERQQVLVTEESFDS
KFYVAHNQFYEQVLVPKNPAFMGKMVEVDIYESGKHFMKGQPVSDAKVYT
PSISKPLAKGEVSGLTKDFRNGLGNQLSSGSHTSAASQCDSASSRMVLPM
PRLHQDCALRMSVGLALLGLLFAFFVKVYN

Entry added on: 2019-01-16 10:53:44.103510, by a user: boccaletto