Protein Summary

ADAT3 from Homo sapiens

Full name: adenosine deaminase, tRNA specific 3
Synonym: TAD3
GI: None
Orf:
COG:
UniProt:
Structures: | Q96EY9 |
Complex:
Enzyme type: deaminase
Position of modification - modification:

Comments:



Protein sequence:

>SP|QEY|ADAT_HUMANPROBABLEINACTIVETRNA-SPECIFICADE
NOSINEDEAMINASE-LIKEPROTEINOS=HOMOSAPIENSOX=GN=ADA
TPE=SV=MEPAPGLVEQPKCLEAGSPEPEPAPWQALPVLSEKQSGDVELV
LAYAAPVLDKRQTSRLLKEVSALHPLPAQPHLKRVRPSRDAGSPHALEML
LCLAGPASGPRSLAELLPRPAVDPRGLGQPFLVPVPARPPLTRGQFEEAR
AHWPTSFHEDKQVTSALAGRLFSTQERAAMQSHMERAVWAARRAAARGLR
AVGAVVVDPASDRVLATGHDCSCADNPLLHAVMVCVDLVARGQGRGTYDF
RPFPACSFAPAAAPQAVRAGAVRKLDADEDGLPYLCTGYDLYVTREPCAM
CAMALVHARILRVFYGAPSPDGALGTRFRIHARPDLNHRFQVFRGVLEEQ
CRWLDPDT

Entry added on: 2019-01-16 10:30:43.715223, by a user: boccaletto