Protein Summary

ADAT2 from Homo sapiens

Full name: adenosine deaminase, tRNA specific 2
Synonym: dJ20N2.1, TAD2
GI: None
Orf:
COG:
UniProt:
Structures: | Q7Z6V5 |
Complex:
Enzyme type: deaminase
Position of modification - modification:

Comments:



Protein sequence:

>SP|QZV|ADAT_HUMANTRNA-SPECIFICADENOSINEDEAMINASEO
S=HOMOSAPIENSOX=GN=ADATPE=SV=MEAKAAPKPAASGACSVSAEE
TEKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRH
AEMVAIDQVLDWCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPL
VVYGCQNERFGGCGSVLNIASADLPNTGRPFQCIPGYRAEEAVEMLKTFY
KQENPNAPKSKVRKKECQKS

Publications

Title Authors Journal Details PubMed Id DOI
RNA editing by adenosine deaminases generates RNA and protein diversity. Schaub M, Keller W... Biochimie [details] 12457566 -

Last modification of this entry: 2019-01-16 10:28:49.550481
Edited by a user: boccaletto
Edited content: Changed papers.