Protein Summary

Trm61 from Saccharomyces cerevisiae

Full name: tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61
Synonym: GCD14
GI: 6322336
Orf: YJL125C
COG: COG2519
UniProt: P46959
Complex: Trm6/Trm61
Enzyme type: methyltransferase
Position of modification - modification: t:58 - m1A

Comments:

AdoMet is the methyl group donor. Heterotetramer composed of mutually related subunits: 2 copies of Trm6p and two copies of Trm61p. Trm61p is a catalytic subunit, Trm6p is a tRNA-binding subunit. Trm6/Trm61 are structuraly related.

Protein sequence:

MSTNCFSGYKDLIKEGDLTLIWVSRDNIKPVRMHSEEVFNTRYGSFPHKD
IIGKPYGSQIAIRTKGSNKFAFVHVLQPTPELWTLSLPHRTQIVYTPDSS
YIMQRLNCSPHSRVIEAGTGSGSFSHAFARSVGHLFSFEFHHIRYEQALE
EFKEHGLIDDNVTITHRDVCQGGFLIKKGDTTSYEFGNNETAASLNANVV
FLDLPAPWDAIPHLDSVISVDEKVGLCCFSPCIEQVDKTLDVLEKYGWTD
VEMVEIQGRQYESRRQMVRSLNDALERLRDIKRHKLQGVERRKRMFNNTI
DSNDEKVGKRNEDGVPLTEKAKFNPFGKGSRIKEGDSNYKWKEVTKMEAE
IKSHTSYLTFAFKVVNRSRDDEKVNEILRSTEK

Enzymatic activities

Reaction Substrate Type Position
A:m1A tRNA (t) Arg/ACU/prokaryotic cytosol 58
A:m1A tRNA (t) Arg/ICG/prokaryotic cytosol 58
A:m1A tRNA (t) Asn/GUU/prokaryotic cytosol 58
A:m1A tRNA (t) Cys/GCA/prokaryotic cytosol 58
A:m1A tRNA (t) Ile/IAU/prokaryotic cytosol 58
A:m1A tRNA (t) Ile/UAU/prokaryotic cytosol 58
A:m1A tRNA (t) Leu/UAG/prokaryotic cytosol 58
A:m1A tRNA (t) Leu/UAA/prokaryotic cytosol 58
A:m1A tRNA (t) Lys/CUU/prokaryotic cytosol 58
A:m1A tRNA (t) Lys/SUU/prokaryotic cytosol 58
A:m1A tRNA (t) Met/CAU/prokaryotic cytosol 58
A:m1A tRNA (t) Phe/GAA/prokaryotic cytosol 58
A:m1A tRNA (t) Pro/UGG/prokaryotic cytosol 58
A:m1A tRNA (t) Thr/IGU/prokaryotic cytosol 58
A:m1A tRNA (t) Trp/CCA/prokaryotic cytosol 58
A:m1A tRNA (t) Tyr/GUA/prokaryotic cytosol 58
A:m1A tRNA (t) Val/UAC/prokaryotic cytosol 58
A:m1A tRNA (t) Val/CAC/prokaryotic cytosol 58
A:m1A tRNA (t) Val/IAC/prokaryotic cytosol 58

Publications

Title Authors Journal Details PubMed Id DOI
The essential Gcd10p-Gcd14p nuclear complex is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA. Anderson J, Phan L, Cuesta R, Carlson BA, Pak M, Asano K, Bjork GR, Tamame M, Hinnebusch AG Genes Dev [details] 9851972 -
Conserved amino acids in each subunit of the heteroligomeric tRNA m1A58 Mtase from Saccharomyces cerevisiae contribute to tRNA binding. Ozanick SG, Bujnicki JM, Sem DS, Anderson JT Nucleic Acids Res [details] 17932071 -

Last modification of this entry: 2012-07-04 13:27:07.647533
Edited by a user: magda
Edited content: Changed protein_sequence, if_enzyme, nomenclature and comments.