Protein Summary

CTU1 from Homo sapiens

Full name: cytosolic thiouridylase subunit 1
Synonym: MGC17332, NCS6
GI: None
Orf:
COG:
UniProt:
Structures: | Q7Z7A3 |
Complex:
Enzyme type: thiolase
Position of modification - modification:

Comments:



Protein sequence:

>SP|QZA|CTU_HUMANCYTOPLASMICTRNA-THIOLATIONPROTEIN
OS=HOMOSAPIENSOX=GN=CTUPE=SV=MPAPPCASCHAARAALRRPLS
GQALCGACFCAAFEAEVLHTVLAGRLLPPGAVVAVGASGGKDSTVLAHVL
RALAPRLGISLQLVAVDEGIGGYRDAALAAVRRQAARWELPLTVVAYEDL
FGGWTMDAVARSTAGSGRSRSCCTFCGVLRRRALEEGARRVGATHIVTGH
NADDMAETVLMNFLRGDAGRLARGGGLGSPGEGGALPRCRPLQFASQKEV
VLYAHFRRLDYFSEECVYAPEAFRGHARDLLKRLEAARPSAVLDLVHSAE
RLALAPAARPPRPGACSRCGALASRALCQACALLDGLNRGRPRLAIGKGR
RGLDEEATPGTPGDPARPPASKAVPTF

Publications

Title Authors Journal Details PubMed Id DOI
A functional proteomics approach links the ubiquitin-related modifier Urm1 to a tRNA modification pathway. Schlieker CD, Van der Veen AG, Damon JR, Spooner E, Ploegh HL... Proc Natl Acad Sci U S A [details] 19017811 -

Last modification of this entry: 2019-01-15 15:25:06.475623
Edited by a user: boccaletto
Edited content: Changed protein_sequence, if_enzyme, enzyme_type and papers.