Protein Summary

Trm7 from Saccharomyces cerevisiae

Full name: tRNA (cytidine(32)/guanosine(34)-2′-O)-methyltransferase
Synonym: Ybr1, FtsJ
GI: 586500
Orf: YBR061C
COG: COG0293
UniProt: P38238
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:34 - Gm
t:34 - ncm5Um
t:32 - Cm

Comments:

Carries out two succesive methylations of anticodon. Activity is stimulated by a not yet identified protein-cofactor (Lecointe, Grosjean, unpublished results).

Protein sequence:

MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDQFHFLDDPNLKRVVDL
CAAPGSWSQVLSRKLFDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADI
THPKTLARILKLFGNEKADFVCSDGAPDVTGLHDLDEYVQQQLIMSALQL
TACILKKGGTFVAKIFRGRDIDMLYSQLGYLFDKIVCAKPRSSRGTSLEA
FIVCLGYNPPSNWTPKLDVNTSVDEFFQGCFLNKLCISDKLSHWNEEERN
IAEFMACGSLQSFDSDATYHDLPSSVAGTSSSLDPVQSPTNPPYKKALEL
KRSGKLTRSV

Enzymatic activities

Reaction Substrate Type Position
C:Cm tRNA (t) Phe/GAA/prokaryotic cytosol 32
G:Gm tRNA (t) Phe/GAA/prokaryotic cytosol 34
C:Cm tRNA (t) Trp/CCA/prokaryotic cytosol 32
C:Cm tRNA (t) Trp/CCA/prokaryotic cytosol 34
C:Cm tRNA (t) Leu/UAA/prokaryotic cytosol 32
ncm5U:ncm5Um tRNA (t) Leu/UAA/prokaryotic cytosol 34

Publications

Title Authors Journal Details PubMed Id DOI
Trm7p catalyses the formation of two 2'-O-methylriboses in yeast tRNA anticodon loop. Pintard L, Lecointe F, Bujnicki JM, Bonnerot C, Grosjean H, Lapeyre B EMBO J [details] 11927565 -
Yeast Trm7 interacts with distinct proteins for critical modifications of the tRNAPhe anticodon loop. Guy MP, Podyma BM, Preston MA, Shaheen HH, Krivos KL, Limbach PA, Hopper AK, Phizicky EM... RNA [details] 22912484 -
Conservation of an intricate circuit for crucial modifications of the tRNAPhe anticodon loop in eukaryotes. Guy MP, Phizicky EM... RNA [details] 25404562 -

Links

_PubMed_

Last modification of this entry: 2015-02-19 16:05:30.311509
Edited by a user: magda
Edited content: Changed additional_information.