Protein Summary

DR_0049 from Deinococcus radiodurans

Full name: DR_0049
Synonym:
GI: None
Orf:
COG:
UniProt:
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification:

Comments:

DR_0049 encodes the methyltransferase producing m5C2499 in D. radiodurans 23S rRNA. Growth experiments disclosed that inactivation of DR_0049 is associated with a severe growth defect.

Protein sequence:

MSAPASSAPRLRLRVSKAAELHIRDGHPWVYESSVREQNREGEPGELAVV
YDRRDRFLAIGLYDPFSPLRLRVLHTGMPTQLDDAWWAARLDAALARRAA
LFGPLTAFGDTDGYRVLNGESDGFPGLVVDRYAGVLVMKLYTAAWFPHLR
RMLELFAARAPDFAVVLRLSRNIAERAADLGLHDGQVIYGELAGDSVVFR
ESGLRFEAEVRQGQKTGFFLDQRENRRRVEGLSEGRRVLNAFSFSGGFSL
YAARGGASEVTSLDISAHALRSAERNFALNPELSAVHKTVQADVFEWLPA
GKGSGADYDLVILDPPSLARREAEREGAIRAYGKLAEGGLTRLAPGGILV
SASCSAHVSAEEFEEAVMSAVRRSGRRWRKLLSSRHAPDHHASFAEAEYL
KAVFLQMD

Publications

Title Authors Journal Details PubMed Id DOI
Identification of the methyltransferase targeting C2499 in Deinococcus radiodurans 23S ribosomal RNA. Mundus J, Flyvbjerg KF, Kirpekar F Extremophiles [details] 26590840 10.1007/s00792-015-0800-z

Entry added on: 2017-09-14 09:17:06.557927, by a user: elapurta