Protein Summary

ABH1 from Homo sapiens

Full name: Nucleic acid dioxygenase ALKBH1
Synonym: ALKBH1
GI: 87298839
Orf:
COG:
UniProt:
Structures: | |
Complex:
Enzyme type:
Position of modification - modification:

Comments:



Protein sequence:

MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAH
AARGKGPGAQKVIKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFI
FIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEETQDLWEQSKEF
LRYKEATKRRPRSLLEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLS
EQVAAACGFEDFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQ
SAIFLLGGLQRDEAPTAMFMHSGDIMIMSGFSRLLNHAVPRVLPNPEGEG
LPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATD
QNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARINPDS

Publications

Title Authors Journal Details PubMed Id DOI
NSUN3 and ABH1 modify the wobble position of mt-tRNAMet to expand codon recognition in mitochondrial translation. Haag S, Sloan KE, Ranjan N, Warda AS, Kretschmer J, Blessing C, Hübner B, Seikowski J, Dennerlein S, Rehling P, Rodnina MV, Höbartner C, Bohnsack MT ENBO J. [details] 27497299 10.15252/embj.201694885

Last modification of this entry: 2017-09-14 13:43:23.657543
Edited by a user: elapurta
Edited content: Changed gi.