Protein Summary

DnmA from Dictyostelium discoideum

Full name: DNA (cytosine-5)-methyltransferase
Synonym: DNA -methyltransferase
GI: None
Orf:
COG:
UniProt: Q54JH6
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:38 - m5C

Comments:



Protein sequence:

MEQLRVLEFYSGIGGMHYGLQESGVDFQVIQSFDINTNANLNYKYTFNED
SSQKSIESYSVEELEGFKANAWLMSPPCQPFTRLGLQKDDQDNRTNSFFH
LLDVLTKIKDPPTYILIENVFGFAKKGSSNTRDHLLDTLIKMNYSFQEFH
LSPQQFGLANQRLRYFCIAKRNGKLNFKKEQDKHNEKVDENKLNNNSNNN
NEQNKYDNLKILDHIPGYDFHTTLEECDEISNYFDKDLTDDELYEKYKVP
HNLLLSKGMLFDIKQKDSKTSNCVTKSYGKFIEGTGSIIQMDNNFKADIN
DNKSLIPLKLRYFSPKEITRLHGFPEEFKFSPKLTTIQCYRLIGNSLNVK
IVSELLKVLVSPNEEEEQQEQQKEKEGKK

Publications

Title Authors Journal Details PubMed Id DOI
Dynamic modulation of Dnmt2-dependent tRNA methylation by the micronutrient queuine. Müller M, Hartmann M, Schuster I, Bender S, Thüring KL, Helm M, Katze JR, Nellen W, Lyko F, Ehrenhofer-Murray AE. Nucleic Acids Res. [details] 26424849 10.1093/nar/gkv980

Last modification of this entry: 2017-04-06 17:29:00.187754
Edited by a user: pboccaletto
Edited content: Changed swiss, protein_sequence and position.