Protein Summary

NAT10 from Homo sapiens

Full name: N-acetyltransferase 10
Synonym: ALP, KIAA1709
GI: 221316723
Orf:
COG: COG1444
UniProt: Q9H0A0
Structures: | |
Complex:
Enzyme type: acetyltransferase
Position of modification - modification: s:1338(1060) - ac4C
s:1843(1510) - ac4C

Comments:

NAT10 is the human homolog of yeast RRA1. It is a disease-associated gene (progeria, laminopathies). NAT10 is required for the formation of two ac4C in human SSU rRNA: one in helix 34, predicted, based on the yeast work, to map to position 1338, and one in helix 45, predicted to be at position 1843. siRNA-mediated depletion of NAT10 also leads to loss of tRNA acetylation. NAT10 interacts in vivo in human cells with THUMPD1, the homolog of TAN1, and a NAT10/THUMPD1 complex is suggested to work in tRNA acetylation in human, similar to the KRE33/TAN1 complex in budding yeast. NAT10 complements both 18S rRNA and tRNA acetylation in yeast.

Protein sequence:

MHRKKVDNRIRILIENGVAERQRSLFVVVGDRGKDQVVILHHMLSKATVK
ARPSVLWCYKKELGFSSHRKKRMRQLQKKIKNGTLNIKQDDPFELFIAAT
NIRYCYYNETHKILGNTFGMCVLQDFEALTPNLLARTVETVEGGGLVVIL
LRTMNSLKQLYTVTMDVHSRYRTEAHQDVVGRFNERFILSLASCKKCLVI
DDQLNILPISSHVATMEALPPQTPDESLGPSDLELRELKESLQDTQPVGV
LVDCCKTLDQAKAVLKFIEGISEKTLRSTVALTAARGRGKSAALGLAIAG
AVAFGYSNIFVTSPSPDNLHTLFEFVFKGFDALQYQEHLDYEIIQSLNPE
FNKAVIRVNVFREHRQTIQYIHPADAVKLGQAELVVIDEAAAIPLPLVKS
LLGPYLVFMASTINGYEGTGRSLSLKLIQQLRQQSAQSQVSTTAENKTTT
TARLASARTLHEVSLQESIRYAPGDAVEKWLNDLLCLDCLNITRIVSGCP
LPEACELYYVNRDTLFCYHKASEVFLQRLMALYVASHYKNSPNDLQMLSD
APAHHLFCLLPPVPPTQNALPEVLAVIQVCLEGEISRQSILNSLSRGKKA
SGDLIPWTVSEQFQDPDFGGLSGGRVVRIAVHPDYQGMGYGSRALQLLQM
YYEGRFPCLEEKVLETPQEIHTVSSEAVSLLEEVITPRKDLPPLLLKLNE
RPAERLDYLGVSYGLTPRLLKFWKRAGFVPVYLRQTPNDLTGEHSCIMLK
TLTDEDEADQGGWLAAFWKDFRRRFLALLSYQFSTFSPSLALNIIQNRNM
GKPAQPALSREELEALFLPYDLKRLEMYSRNMVDYHLIMDMIPAISRIYF
LNQLGDLALSAAQSALLLGIGLQHKSVDQLEKEIELPSGQLMGLFNRIIR
KVVKLFNEVQEKAIEEQMVAAKDVVMEPTMKTLSDDLDEAAKEFQEKHKK
EVGKLKSMDLSEYIIRGDDEEWNEVLNKAGPNASIISLKSDKKRKLEAKQ
EPKQSKKLKNRETKNKKDMKLKRKK

Enzymatic activities

Reaction Substrate Type Position
C:ac4C rRNA (r) SSU/18S/cytosolic 1843
C:ac4C rRNA (r) SSU/18S/cytosolic 1338

Publications

Title Authors Journal Details PubMed Id DOI
Human NAT10 is an ATP-dependent RNA acetyltransferase responsible for N4-acetylcytidine formation in 18S rRNA. Ito S, Horikawa S, Suzuki T, Kawauchi H, Tanaka Y, Suzuki T, Suzuki T... J Biol Chem [details] 25411247 -
Yeast Kre33 and human NAT10 are conserved 18S rRNA cytosine acetyltransferases that modify tRNAs assisted by the adaptor Tan1/THUMPD1. Sharma S, Langhendries JL, Watzinger P, Kotter P, Entian KD, Lafontaine DL... Nucleic Acids Res [details] 25653167 -

Links

_PubMed_

Last modification of this entry: 2015-02-18 09:52:36.357043
Edited by a user: magda
Edited content: Changed position.