Protein Summary

TrmO from Escherichia coli

Full name: tRNA-methyltransferase O
Synonym: TsaA, YaeB
GI: 16128188
Orf:
COG: COG1720
UniProt: P28634
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:37 - m6t6A

Comments:

TrmO has a unique single-sheeted beta-barrel structure and does not belong to any known classes of methyltransferases (as for August 2014). It employs S-adenosyl-L-methionine as a methyl donor and hence represents a novel category of AdoMet-dependent methyltransferase (Class VIII). In the tRNA substrate C31-G39 and G34 are major determinants of m6t6A formation.

Protein sequence:

MSSFQFEQIGVIRSPYKEKFAVPRQPGLVKSANGELHLIAPYNQADAVRG
LEAFSHLWILFVFHQTMEGGWRPTVRPPRLGGNARMGVFATRSTFRPNPI
GMSLVELKEVVCHKDSVILKLGSLDLVDGTPVVDIKPYLPFAESLPDASA
SYAQSAPAAEMAVSFTAEVEKQLLTLEKRYPQLTLFIREVLAQDPRPAYR
KGEETGKTYAVWLHDFNVRWRVTDAGFEVFALEPR

Enzymatic activities

Reaction Substrate Type Position
t6A:m6t6A tRNA (t) Thr/GGU/prokaryotic cytosol 37

Publications

Title Authors Journal Details PubMed Id DOI
The methyl group of the N6-methyl-N6-threonylcarbamoyladenosine in tRNA of Escherichia coli modestly improves the efficiency of the tRNA. Qian Q, Curran JF, Bjork GR J Bacteriol [details] 9537379 -
Discovery of the beta-barrel-type RNA methyltransferase responsible for N6-methylation of N6-threonylcarbamoyladenosine in tRNAs. Kimura S, Miyauchi K, Ikeuchi Y, Thiaville PC, de Crecy-Lagard V, Suzuki T... Nucleic Acids Res [details] 25063302 -

Links

_PubMed -_

Last modification of this entry: 2015-09-24 12:44:27.885701
Edited by a user: magda
Edited content: Changed papers.