Protein Summary

MRM1 from Homo sapiens

Full name: rRNA methyltransferase 1, mitochondrial
Synonym:
GI: 40068479
Orf:
COG: COG0566
UniProt: Q6IN84
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: l:1145(2251) - Gm

Comments:

Mitochondrial.

Protein sequence:

MALLSTVRGATWGRLVTRHFSHAARHGERPGGEELSRLLLDDLVPTSRLE
LLFGMTPCLLALQAARRSVARLLLQAGKAGLQGKRAELLRMAEARDIPVL
RPRRQKLDTMCRYQVHQGVCMEVSPLRPRPWREAGEASPGDDPQQLWLVL
DGIQDPRNFGAVLRSAHFLGVDKVITSRRNSCPLTPVVSKSSAGAMEVMD
VFSTDDLTGFLQTKAQQGWLVAGTVGCPSTEDPQSSEIPIMSCLEFLWER
PTLLVLGNEGSGLSQEVQASCQLLLTILPRRQLPPGLESLNVSVAAGILL
HSICSQRKGFPTEGERRQLLQDPQEPSARSEGLSMAQHPGLSSGPEKERQ
NEG

Enzymatic activities

Reaction Substrate Type Position
G:Gm rRNA (r) LSU/16S/mitochondrial 1145

Publications

Title Authors Journal Details PubMed Id DOI
Assignment of 2'-O-methyltransferases to Modification Sites on the Mammalian Mitochondrial Large Subunit 16S rRNA. Lee KW, Bogenhagen DF... J Biol Chem [details] 25074936 -

Entry added on: 2014-08-14 14:45:35.738829, by a user: magda