Protein Summary

RNMTL1 from Homo sapiens

Full name: RNA methyltransferase-like protein 1
Synonym:
GI: 8922534
Orf: HC90
COG: COG0566
UniProt: Q9HC36
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: l:1370(2553) - Gm

Comments:

Mitochondrial.

Protein sequence:

MAALVRPARFVVRPLLQVVQAWDLDARRWVRALRRSPVKVVFPSGEVVEQ
KRAPGKQPRKAPSEASAQEQREKQPLEESASRAPSTWEESGLRYDKAYPG
DRRLSSVMTIVKSRPFREKQGKILLEGRRLISDALKAGAVPKMFFFSRLE
YLKELPVDKLKGVSLIKVKFEDIKDWSDLVTPQGIMGIFAKPDHVKMTYP
KTQLQHSLPLLLICDNLRDPGNLGTILRSAAGAGCSKVLLTKGCVDAWEP
KVLRAGMGAHFRMPIINNLEWETVPNYLPPDTRVYVADNCGLYAQAEMSN
KASDHGWVCDQRVMKFHKYEEEEDVETGASQDWLPHVEVQSYDSDWTEAP
AAVVIGGETYGVSLESLQLAESTGGKRLLIPVVPGVDSLNSAMAASILLF
EGKRQLRGRAEDLSRDRSYH

Enzymatic activities

Reaction Substrate Type Position
G:Gm rRNA (r) LSU/16S/mitochondrial 1370

Publications

Title Authors Journal Details PubMed Id DOI
Assignment of 2'-O-methyltransferases to Modification Sites on the Mammalian Mitochondrial Large Subunit 16S rRNA. Lee KW, Bogenhagen DF... J Biol Chem [details] 25074936 -

Last modification of this entry: 2014-08-14 14:41:40.401460
Edited by a user: magda
Edited content: Changed protein_sequence and comments.