Protein Summary

Dnmt2 from Geobacter sulfurreducens

Full name: tRNA (cytosine(38)-C(5))-methyltransferase
Synonym: GSU0227
GI: 39995337
Orf:
COG:
UniProt: Q74GL9
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:38 - m5C

Comments:

In contrast to Dnmt2 methyltransferases from eukaryotes which methylate C38 of tRNAAsp, this enzyme methylates C38 in tRNAGlu. This swapped tRNA specificity is dependent on the differences in the sequence of variable loop in the substrate tRNAs.

Protein sequence:

MRAVELFCGIGGFAAAVEGTGVRVVAAMDQDEAALATYRLNFPGHGARKV
DLERVSAWELTAGGVDLWWLSPPCQPYCERGVRRDLADPRARSLVHILNL
AARMSDEALPRHLALENVAGFVGSEAHGRLTEVLSSRGYRLQERLLCPTE
LGIPSRRPRYYLAASRESLAPAEVLSPLPRQPLAEYLDLLPANGQPAELL
LSPAIVERFGAGFRILDPADPDAYTTCFTSGYGRSLTASGAYLRCSDGVR
RFSPEEIARLLHFPPSFRFPEEVPLRKRWQLVGNSLSVAAVREVLRALPL
PAEEG

Enzymatic activities

Reaction Substrate Type Position
C:m5C tRNA (t) Glu/unknown/prokaryotic cytosol 38

Publications

Title Authors Journal Details PubMed Id DOI
The Dnmt2 RNA methyltransferase homolog of Geobacter sulfurreducens specifically methylates tRNA-Glu. Shanmugam R, Aklujkar M, Schafer M, Reinhardt R, Nickel O, Reuter G, Lovley DR, Ehrenhofer-Murray A, Nellen W, Ankri S, Helm M, Jurkowski TP, Jeltsch A... Nucleic Acids Res [details] 24711368 -

Links

_PubMed_

Entry added on: 2014-06-24 14:42:40.639653, by a user: magda