Protein Summary

ArcS from Methanocaldococcus jannaschii

Full name: glutamine:preQ0-tRNA amidinotransferase or Archaeosine Synthase
Synonym: Archaeosine synthase, Glutamine:preQ0-tRNA amidinotransferase
GI: 3024970
Orf:
COG: COG1549
UniProt: Q58428
Structures: | |
Complex:
Enzyme type: amidinotransferase
Position of modification - modification: t:15 - G+

Comments:



Protein sequence:

MLEPIAYDIGRLCKEEDKELTPKLIDIDVIGLSQEKIFYGIMTPFRCPNS
KSIYELRKSYVKADGIKMPFDTFRELTSIFKKSFIGTVKYKGNVFKYQIL
NFGKHVDLIELEDADLYIIADGRRLIERKELQIIPKIREKISPNSAIYSP
AVFPWEIPLLAYIGVDYFDDSLAKLYASMGYKFTKNRAVKVDSFSFEELY
NNNKKVYEEILEEVRIAIKNGFLRNVVEETAVSHPYLWANYRRYEPDLRN
IPLSKENKIIVTTNINIPEVKKYLERLDNYEPYSNIIVLLPCSSKKPYSI
SQSHQKFIKAIKSAKVVVEEVILTSPYGLVPRALERLVNYDIPVTGEWSF
EEIELINNCLKNFLKKVKEKFDDYIVIAHLPEHYLEILELDDIVITSKGN
PTSEEALKNLTDTLKKYKELTKSKDINKKGQRIHNIQQLAEFQFGINFIP
NEIFINHKGQIFTKINNKNQQIASINPKNGLLILTLSGGELLWNSGGKDI
NYIEVNYEIKKGSLFPPGFVDCNENISYNDEVVLIKDDTFLGIGRALMSG
FEMKKAKHGALVNIRNVKS

Enzymatic activities

Reaction Substrate Type Position
preQ0tRNA:G+ tRNA (t) 15

Publications

Title Authors Journal Details PubMed Id DOI
Discovery and characterization of an amidinotransferase involved in the modification of archaeal tRNA. Phillips G, Chikwana VM, Maxwell A, El-Yacoubi B, Swairjo MA, Iwata-Reuyl D, de Crecy-Lagard V... J Biol Chem [details] 20129918 -

Last modification of this entry: 2014-06-04 16:57:28.039844
Edited by a user: magda
Edited content: Changed papers.