Protein Summary

Trm4 from Pyrococcus abyssi

Full name: tRNA (cytosine(49)-C(5))-methyltransferase
Synonym: PYRAB06230
GI: 14520840
Orf: PAB1947
COG: COG0144
UniProt: Q9V106
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:49 - m5C

Comments:

Catalyzes m5C formation at several cytosines within tRNAs, with preference for C49. The specificity of the enzyme is increased by complex formation with protein archease (PAB1946) encoded upstream from the MTase gene (PAB1947).

Protein sequence:

MKRWEHYEHTADIGIRGYGDSLEEAFEAVAIALFDVIVNVNKVEKKEVRE
VEVEGEDLESLLYNFLEELLVIHDIEGLVFRDFEVKIEKTEKGYKLKAKA
YGEKLDPEKHEPKEEVKAITYHDMKIEKLPDGRWMAQLVPDI

Enzymatic activities

Reaction Substrate Type Position
C:m5C tRNA (t)   49

Publications

Title Authors Journal Details PubMed Id DOI
Archease from Pyrococcus abyssi improves substrate specificity and solubility of a tRNA m5C methyltransferase. Auxilien S, El Khadali F, Rasmussen A, Douthwaite S, Grosjean H... J Biol Chem [details] 17470432 -

Links

_PubMed_

Last modification of this entry: 2014-06-03 17:03:02.570447
Edited by a user: magda
Edited content: No fields changed.