Protein SummaryTaw22 from Pyrococcus abyssi |
Full name: | tRNA (guanine(37)-N1)-methyltransferase Trm5a/Taw22 |
---|---|
Synonym: | Trm5a |
GI: | 14520331 |
Orf: | PAB2272 |
COG: | COG2520 |
UniProt: | Q9V2G1 |
Structures: | | | |
Complex: | |
Enzyme type: | methyltransferase |
Position of modification - modification: |
t:37 - mimG |
Comments:
In P. abyssi two paralogs capable of forming m1G37 are present: Trm5b and Taw22 (Trm5a, a bifunctional enzyme). Under identical experimental conditions Taw22 is more selective for G37-containing tRNAPhe. Taw22 is a tRNA:m1G/imG2 methyltransferase, acting on two chemically distinct guanosine derivatives located at the same position of tRNAPhe, unique to certain archaea. It does not have homologs in eukaryotes.Protein sequence:
MSGVKVRREDAKKVLELLKSVGILDGKRKAIRDEKYVIFPVTDTNIAKSL GLEVVDVELPMRPERQIYKNLEDLLPREIFKKLGRLDIVGDIAIVSIPDE ILSEREVIVSAIRKLYPKVKVIARRGFHSGLYRIRELEVIWGENRLHTIH KENGVLIKVDLSKVFFNPRMKGERYRIAQLVNDGERILVPFAGVIPYPLV IARFKNVEVYAVEINEFAVKLAEENLELNRDRLKGKIKIIHGDVFEVLPN LPNFDRVVSPTPKGVDALSLTLSKAEKFLHYYDFVHESEIERFRERVLEE CRRQGKECRVSVRKVSDYKPHVYKVCADVEILS |
Enzymatic activities
Reaction | Substrate | Type | Position |
---|---|---|---|
G:m1G | tRNA (t) | Phe/GAA/prokaryotic cytosol | 37 |
imG-14:imG2 | tRNA (t) | Phe/GAA/prokaryotic cytosol | 37 |
Publications
Title | Authors | Journal | Details | ||
---|---|---|---|---|---|
Biosynthesis of wyosine derivatives in tRNA: an ancient and highly diverse pathway in Archaea. | de Crecy-Lagard V, Brochier-Armanet C, Urbonavicius J, Fernandez B, Phillips G, Lyons B, Noma A, Alvarez S, Droogmans L, Armengaud J, Grosjean H | Mol Biol Evol | [details] | 20382657 | - |
Biosynthesis of wyosine derivatives in tRNA(Phe) of Archaea: role of a remarkable bifunctional tRNA(Phe):m1G/imG2 methyltransferase. | Urbonavicius J, Meskys R, Grosjean H... | RNA | [details] | 24837075 | - |
Last modification of this entry: 2014-08-19 13:08:41.815077
Edited by a user: magda
Edited content: Changed papers.