Protein Summary

Taw22 from Pyrococcus abyssi

Full name: tRNA (guanine(37)-N1)-methyltransferase Trm5a/Taw22
Synonym: Trm5a
GI: 14520331
Orf: PAB2272
COG: COG2520
UniProt: Q9V2G1
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:37 - mimG

Comments:

In P. abyssi two paralogs capable of forming m1G37 are present: Trm5b and Taw22 (Trm5a, a bifunctional enzyme). Under identical experimental conditions Taw22 is more selective for G37-containing tRNAPhe. Taw22 is a tRNA:m1G/imG2 methyltransferase, acting on two chemically distinct guanosine derivatives located at the same position of tRNAPhe, unique to certain archaea. It does not have homologs in eukaryotes.

Protein sequence:

MSGVKVRREDAKKVLELLKSVGILDGKRKAIRDEKYVIFPVTDTNIAKSL
GLEVVDVELPMRPERQIYKNLEDLLPREIFKKLGRLDIVGDIAIVSIPDE
ILSEREVIVSAIRKLYPKVKVIARRGFHSGLYRIRELEVIWGENRLHTIH
KENGVLIKVDLSKVFFNPRMKGERYRIAQLVNDGERILVPFAGVIPYPLV
IARFKNVEVYAVEINEFAVKLAEENLELNRDRLKGKIKIIHGDVFEVLPN
LPNFDRVVSPTPKGVDALSLTLSKAEKFLHYYDFVHESEIERFRERVLEE
CRRQGKECRVSVRKVSDYKPHVYKVCADVEILS

Enzymatic activities

Reaction Substrate Type Position
G:m1G tRNA (t) Phe/GAA/prokaryotic cytosol 37
imG-14:imG2 tRNA (t) Phe/GAA/prokaryotic cytosol 37

Publications

Title Authors Journal Details PubMed Id DOI
Biosynthesis of wyosine derivatives in tRNA: an ancient and highly diverse pathway in Archaea. de Crecy-Lagard V, Brochier-Armanet C, Urbonavicius J, Fernandez B, Phillips G, Lyons B, Noma A, Alvarez S, Droogmans L, Armengaud J, Grosjean H Mol Biol Evol [details] 20382657 -
Biosynthesis of wyosine derivatives in tRNA(Phe) of Archaea: role of a remarkable bifunctional tRNA(Phe):m1G/imG2 methyltransferase. Urbonavicius J, Meskys R, Grosjean H... RNA [details] 24837075 -

Last modification of this entry: 2014-08-19 13:08:41.815077
Edited by a user: magda
Edited content: Changed papers.