Protein Summary

Bmt5 from Saccharomyces cerevisiae

Full name:
Synonym:
GI: 6322095
Orf: YIL096C
COG:
UniProt: P40493
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: l:2634(2265) - m3U

Comments:

Localizes in the nucleolus.

Protein sequence:

MARKLKGKIGSKGLKGALLRHKAKVKLVRNIESKQKHELRKKNSSANNKT
VKRNQEFQKLNQGKVMPFEKDETLMLCGEGDFSFARSIVEQNYIESDNLI
ITSYDNSVNELKLKYPHTFEENYQYLKDLNIPIFFQIDVTKLVKSFKISK
NNTWFKIINRLSDHRWGNKPLQNIVFNFPHNGKGIKDQERNIREHQDLIF
NFFQNSLQLFNLINTKIQNDTLRYTQGYDLNEDTPQAKKLTAEGYGNIIL
SLFDGEPYDSWQIKLLAKKNGLTLSRSSKFQWENFPGYHHRRTNSEQDTT
KPAKERDARFYIFSKYVSNSSKHNRKSKKDTDSDSD

Enzymatic activities

Reaction Substrate Type Position
U:m3U rRNA (r) LSU-L/25S/cytosolic 2634

Publications

Title Authors Journal Details PubMed Id DOI
Identification of novel methyltransferases, Bmt5 and Bmt6, responsible for the m3U methylations of 25S rRNA in Saccharomyces cerevisiae. Sharma S, Yang J, Duttmann S, Watzinger P, Kotter P, Entian KD... Nucleic Acids Res [details] 24335083 -

Links

_PubMed_

Last modification of this entry: 2013-12-23 11:56:08.683300
Edited by a user: magda
Edited content: Changed comments.