Protein Summary

METTL14 from Homo sapiens

Full name:
Synonym: KIAA1627
GI: 24308265
Orf:
COG: COG4725
UniProt: Q9HCE5
Structures: | |
Complex: METTL3-METTL14
Enzyme type: methyltransferase
Position of modification - modification: m:many - m6A

Comments:

METTL14 is a methyltransferase which forms a stable heterodimer with METTL3. The complex mediates m6A deposition on nuclear RNA.

Protein sequence:

MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRET
CRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEENLPYEEEIY
KDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLR
ELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYR
ETGITANEKCWTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCLRK
WGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVKRST
DGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRD
STIRPGWLTVGPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSP
PPKSKSDRGGGAPRGGGRGGTSAGRGRERNRSNFRGERGGFRGGRGGAHR
GGFPPR

Enzymatic activities

Reaction Substrate Type Position
A:m6A mRNA (m) many

Publications

Title Authors Journal Details PubMed Id DOI
A METTL3-METTL14 complex mediates mammalian nuclear RNA N-adenosine methylation. Liu J, Yue Y, Han D, Wang X, Fu Y, Zhang L, Jia G, Yu M, Lu Z, Deng X, Dai Q, Chen W, He C... Nat Chem Biol [details] 24316715 -

Links

_PubMed_

Last modification of this entry: 2013-12-20 15:44:31.285436
Edited by a user: magda
Edited content: Changed protein_sequence and position.