Protein Summary

Trm3 from Saccharomyces cerevisiae

Full name: tRNA (guanosine(18)-2′-O)-methyltransferase
Synonym:
GI: 74627230
Orf: YDL112W
COG: COG0566
UniProt: Q07527
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:18 - Gm

Comments:

AdoMet is the methyl group donor. Site-specific. SPOUT superfamily. Methylates Gm18 in all intron-less yeast tRNAs known to possess this modification.

Protein sequence:

MVGGALICKYLPREEQLKLISDLIQNDSLEEVLELIETSPLDITTDSNIE
TPIFEKITEQVIAYASIDGEAREMFRSSRAEMNKALRTSAQLLCCLPSVW
HKFQVWMSYRLNDIISENYKHLFNDNFGKKIVQPFFDSFAEEQNANIKHE
NLHLDILSLLHYLEVVYLFDECKNGISSKCLDFIIVPLLGCNSEEIADSC
SKLMRWHIKYLSKCCNTDSNFDKLIWTFIKQLYAEGSQQAWKQKNSLSFL
LRFLLAAELSPELITYIKTDAYWRHIQTELDNDVHEHRKLALSILKLTIQ
KLSSHGITLQTTFYKCNDLANIEMLGSWKKFTTLYEMIALDTSLNQIQAA
KQDIIKIFDNEHLHHSWGLILLSTGLKSSMESVRKYMMTLMFSITNMSAF
SSNLPLLTKTLLPAAMSAHYFDVKGVSCPHGEKLSLFVNNLLSQTTEGIS
DILFEILKLLVEKGTSFDPSRIYLSYGILVFFQNNKQKTINSDHLSLIRK
LYDFAAEEEVLETTIQTIYLKFLLYIDPSVSASELLFTLVSHIKLKGGTY
KYVEPLFEDYRDLAVSHFDDLQAKENLTTNIGKDTIFDLLASIIFDFKDI
DITPDFLIEVAKSKQDIPVYTSKAVTFLTQLLSGEPSNGYTYENATALLS
YPNFTISTWKSINVNNLFKSVMEKFSLDKFKFFAEIYQKTYECRFDTIEL
NFNDLLSLYEMVKKSANQCSRESFKVKDSAYSSYFELLNTFLKTYALNRD
SSEGNDDELHILLRLVDENINKDNGNYLGNLAVCKLLYFIIDSYIHCSTS
VSDDDIFIVKFIFEKFSFIWECINSERLVLKERDLHLMLIKGLFHPVILY
FGSNQYIDTLTSKLEEHAQTIISLSYSRRSLLPLLGSQLRVFMKFYGKLL
REDVNYWWLINIIVGVFKQPQMDVNLYKLKPVISSLFDHKLNNYYIKGDE
LYEKVYGPDEILARVSIIDSILYANDQLKIRLIEKVTEKTNALYAIKRTD
GAEALQRLLQWQLLLLSLLTTNEKKLSETSMIRILKSIEDESSPLVRVYK
EWFISSKVVDYYKTGNPKFAEDYLFSLLEDHSKPVFVVSAEKICFMVLKD
LRNDEKKYGFTQLLDRFICTLVPNAASNKPLVRHFSNSLIISLWPTFKAY
LSDHTLRNIIENLYSNAKKTQIFGQYRAGDANIWDLKGDRKLTNMFGGVL
KKVTDHDCPYISESVFEKYLQEKDIVPIGTDERSLWLDKRDTNTESVNNA
NISCDTSPLQTKSGAWETVLDLDNKKSNDVVTRSELIVVSSLVDKPPNLG
GICRLCDVLGVGLLTVQDIKVKNHPQFKNVAVTADRWMPMEEVALDEIAS
FMKEKKKEGYTLIGLEQTDKSVKLDNNFQFPKKSLILLGTEAFGIPGTLL
SELDLCLEIQQFGVIRSMNIQTATAVIVHSYTVQHM

Enzymatic activities

Reaction Substrate Type Position
G:Gm tRNA (t) Leu/UAG/prokaryotic cytosol 18
G:Gm tRNA (t) Leu/CAA/prokaryotic cytosol 18
G:Gm tRNA (t) Leu/UAA/prokaryotic cytosol 18
G:Gm tRNA (t) His/GUG/prokaryotic cytosol 18
G:Gm tRNA (t) Tyr/GUA/prokaryotic cytosol 18
G:Gm tRNA (t) Ser/CGA/prokaryotic cytosol 18
G:Gm tRNA (t) Ser/UGA/prokaryotic cytosol 18
G:Gm tRNA (t) Ser/IGA/prokaryotic cytosol 18
G:Gm tRNA (t) Trp/CCA/prokaryotic cytosol 18

Publications

Title Authors Journal Details PubMed Id DOI
The yeast Saccharomyces cerevisiae YDL112w ORF encodes the putative 2'-O-ribose methyltransferase catalyzing the formation of Gm18 in tRNAs. Cavaille J, Chetouani F, Bachellerie JP RNA [details] 9917067 -

Last modification of this entry: 2012-07-04 13:23:07.306436
Edited by a user: magda
Edited content: Changed protein_sequence, if_enzyme, nomenclature and comments.