Protein Summary

TrmH from Thermus thermophilus

Full name: tRNA (guanosine(18)-2′-O)-methyltransferase
Synonym: SpoU
GI: 55980096
Orf: TTHA0127
COG: COG0566
UniProt: Q9FAC4
Structures: | 1V2X |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:18 - Gm

Comments:

T. thermophilus TrmH is a Class IV AdoMet-dependent methyltransferase.

Protein sequence:

MRERTEARRRRIEEVLRRRQPDLTVLLENVHKPHNLSAILRTCDAVGVLE
AHAVNPTGGVPTFNETSGGSHKWVYLRVHPDLHEAFRFLKERGFTVYATA
LREDARDFREVDYTKPTAVLFGAEKWGVSEEALALADGAIKIPMLGMVQS
LNVSVAAAVILFEAQRQRLKAGLYDRPRLDPELYQKVLADWLRK

Enzymatic activities

Reaction Substrate Type Position
G:Gm tRNA (t) all/all/cytosolic 18

Publications

Title Authors Journal Details PubMed Id DOI
Identification and characterization of tRNA (Gm18) methyltransferase from Thermus thermophilus HB8: domain structure and conserved amino acid sequence motifs. Hori H, Suzuki T, Sugawara K, Inoue Y, Shibata T, Kuramitsu S, Yokoyama S, Oshima T, Watanabe K... Genes Cells [details] 11918670 -
Substrate recognition of tRNA (Guanosine-2'-)-methyltransferase from Thermus thermophilus HB27. Hori H, Yamazaki N, Matsumoto T, Watanabe Y, Ueda T, Nishikawa K, Kumagai I, Watanabe K... J Biol Chem [details] 9748240 -
Deep knot structure for construction of active site and cofactor binding site of tRNA modification enzyme. Nureki O, Watanabe K, Fukai S, Ishii R, Endo Y, Hori H, Yokoyama S... Structure [details] 15062082 -
The catalytic domain of topological knot tRNA methyltransferase (TrmH) discriminates between substrate tRNA and non-substrate tRNA via an induced-fit process. Ochi A, Makabe K, Yamagami R, Hirata A, Sakaguchi R, Hou YM, Watanabe K, Nureki O, Kuwajima K, Hori H... J Biol Chem [details] 23867454 -

Links

_PubMed_

Last modification of this entry: 2013-08-05 13:32:17.705237
Edited by a user: magda
Edited content: Changed position, additional_information and comments.