Protein Summary

FTO from Homo sapiens

Full name: Alpha-ketoglutarate-dependent dioxygenase FTO
Synonym: KIAA1752
GI: 122937263
Orf:
COG:
UniProt: Q9C0B1
Structures: | 3LFM |
Complex:
Enzyme type: demethylase
Position of modification - modification: m:many - A
m:many - f6A
m:many - hm6A

Comments:

The human fat mass and obesity-associated protein FTO catalyses the removal of m6A in vitro and in vivo. It is a member of the non-haem FeII/a-ketoglutarate (a-KG)-dependent AlkB family demethylases that mainly catalyse oxidative demethylation of N-alkylated nucleic acid bases. FTO oxidizes m6A to hm6A and f6A in RNA in a step-wise manner. FTO was identified in several genome-wide-association studies to be associated with obesity and type II diabetes.

Protein sequence:

MKRTPTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLI
LREASSVSEELHKEVQEAFLTLHKHGCLFRDLVRIQGKDLLTPVSRILIG
NPGCTYKYLNTRLFTVPWPVKGSNIKHTEAEIAAACETFLKLNDYLQIET
IQALEELAAKEKANEDAVPLCMSADFPRVGMGSSYNGQDEVDIKSRAAYN
VTLLNFMDPQKMPYLKEEPYFGMGKMAVSWHHDENLVDRSAVAVYSYSCE
GPEEESEDDSHLEGRDPDIWHVGFKISWDIETPGLAIPLHQGDCYFMLDD
LNATHQHCVLAGSQPRFSSTHRVAECSTGTLDYILQRCQLALQNVCDDVD
NDDVSLKSFEPAVLKQGEEIHNEVEFEWLRQFWFQGNRYRKCTDWWCQPM
AQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRR
EWHARCQSRIARTLPADQKPECRPYWEKDDASMPLPFDLTDIVSELRGQL
LEAKP

Enzymatic activities

Reaction Substrate Type Position
m6A:A mRNA (m) many
m6A:hm6A mRNA (m) many
hm6A:f6A mRNA (m) many

Publications

Title Authors Journal Details PubMed Id DOI
FTO-mediated formation of N(6)-hydroxymethyladenosine and N(6)-formyladenosine in mammalian RNA. Fu Y, Jia G, Pang X, Wang RN, Wang X, Li CJ, Smemo S, Dai Q, Bailey KA, Nobrega MA, Han KL, Cui Q, He C... Nat Commun [details] 23653210 -
N6-methyladenosine in nuclear RNA is a major substrate of the obesity-associated FTO. Jia G, Fu Y, Zhao X, Dai Q, Zheng G, Yang Y, Yi C, Lindahl T, Pan T, Yang YG, He C... Nat Chem Biol [details] 22002720 -
Crystal structure of the FTO protein reveals basis for its substrate specificity. Han Z, Niu T, Chang J, Lei X, Zhao M, Wang Q, Cheng W, Wang J, Feng Y, Chai J... Nature [details] 20376003 -
Molecular biology. Internal mRNA methylation finally finds functions. Nilsen TW... Science [details] 24626918 -
FTO-dependent demethylation of N6-methyladenosine regulates mRNA splicing and is required for adipogenesis. Zhao X, Yang Y, Sun BF, Shi Y, Yang X, Xiao W, Hao YJ, Ping XL, Chen YS, Wang WJ, Jin KX, Wang X, Huang CM, Fu Y, Ge XM, Song SH, Jeong HS, Yanagisawa H, Niu Y, Jia GF, Wu W, Tong WM, Okamoto A, He C, Rendtlew Danielsen JM, Wang XJ, Yang YG... Cell Res [details] 25412662 -

Links

_PubMed_

Last modification of this entry: 2014-12-23 17:58:43.495010
Edited by a user: magda
Edited content: Changed papers.