Protein Summary

Bmt2 from Saccharomyces cerevisiae

Full name:
Synonym: YBR141C
GI: 330443457
Orf: YBR1118
COG:
UniProt: P38278
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: l:2142(1784) - m1A

Comments:

Intriduces m1A2142 modification of helix 65 in domain IV of 25S rRNA. Predicted to be an Ado-Met dependent methyltransferase from Rossmann fold superfamily. The loss of m1A2142 modification confers anisomycin and peroxide sensitivity to the cells.

Protein sequence:

MHSRKSKSITGKRKQVGSNVTRVIKPQKTRRIIRRFHHLINKRQSICKFL
CLKENLDDSNEEKNDKIIRLSIKGNVRLGKYYEDGKSQSFNDAMESQLLR
LHSLIKNESKSKDTSDLAVMYTLLGYIMNQINKLGGLETYQIASQNGQLK
ERGGDTSKLLEKWIRSSFENCPGAVALEIGSLSSGNRISRCALFRNVVRI
DLEEHEGVIKQDFMERPLPRNENDKFDLISCSLVLNFVKNHRDRGAMCHR
MVKFLKPQGYIFIVLPQACVTHSRYCDKTLLQNLLGSIGLIMLNSHQSNK
LYYCLYQLQVVPPQPSSFSKRIKVNDGPGLNNFGITL

Enzymatic activities

Reaction Substrate Type Position
A:m1A rRNA (r) LSU-L/25S/cytosolic 2142

Publications

Title Authors Journal Details PubMed Id DOI
Identification of a novel methyltransferase, Bmt2, responsible for the N-1-methyl-adenosine base modification of 25S rRNA in Saccharomyces cerevisiae Sunny Sharma, Peter Watzinger, Peter K├Âtter, and Karl-Dieter Entian Nucleic Acids Res [details] 23558746 10.1093/nar/gkt195

Last modification of this entry: 2013-04-04 12:40:32.417126
Edited by a user: magda
Edited content: Changed comments.