Protein Summary

Rrp8 from Saccharomyces cerevisiae

Full name: Ribosomal RNA-processing protein 8
Synonym: YDR083W
GI: 398365487
Orf: D4461
COG: COG0500
UniProt: P38961
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: l:645(571) - m1A

Comments:

Required for efficient pre-35S rRNA cleavage at site A2. Remains associated to the resulting 27S product. Also involved in telomere length regulation and maintenance. This nucleolar Rossmann-fold like protein is highly conserved in eukaryotes and catalyses the N1-methylation of A645 in helix 25.1 of 25S rRNA. However the methylation function is independent of the A2-cleavage reaction, attesting that Rrp8p has a dual function. The introduction of a methyl group at N1 of adenosine, introduces a positive charge to the nucleoside.

Protein sequence:

MALFNVEGWSIKTKTVAFDNKTNKSSKDKKKNNRKNGKLTREQKLKEETE
AELKEQVEDIPSEGSVAKDIPKKNQEKSDQNETSKKRKHDEEAPLMQVKE
NIEKPTKKQLTPLQQKMMAKLTGSRFRWINEQLYTISSDEALKLIKEQPQ
LFDEYHDGFRSQVQAWPENPVDVFVDQIRYRCMKPVNAPGGLPGLKDSKE
IVIADMGCGEAQLALEINNFFKNYNKKAKKYLKRRHKVHSFDLKKANERI
TVADIRNVPLPDESCTIVVFCLALMGTNFLDFIKEAYRILAPRGELWIAE
IKSRFSDGKGNEFVDALKLMGFFHKKTFDENKMFTRFEFFKPPAEIIEER
RQKLERRQKFIEVETEKEELEKKRRKIAEGKWLLKPCIYKRR

Enzymatic activities

Reaction Substrate Type Position
A:m1A rRNA (r) LSU-L/25S/cytosolic 645

Publications

Title Authors Journal Details PubMed Id DOI
Rrp8p is a yeast nucleolar protein functionally linked to Gar1p and involved in pre-rRNA cleavage at site A2. Bousquet-Antonelli C, Vanrobays E, Gelugne JP, Caizergues-Ferrer M, Henry Y... RNA [details] 10864042 -
Yeast Rrp8p, a novel methyltransferase responsible for m1A 645 base modification of 25S rRNA. Peifer C, Sharma S, Watzinger P, Lamberth S, Kotter P, Entian KD... Nucleic Acids Res [details] 23180764 -

Links

_PubMed_
_SGD_

Last modification of this entry: 2013-02-14 10:52:03.469806
Edited by a user: magda
Edited content: Changed comments.