Protein Summary

BCDIN3D from Homo sapiens

Full name: BCDIN3 domain containing
Synonym:
GI: 32171233
Orf:
COG:
UniProt: Q7Z5W3
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: pre-miRNA:0 - mm(pN)

Comments:

Methylation of the 5′ monophosphate of pre-miRNAs by BCDIN3D inhibits their processing by Dicer.

Protein sequence:

MAVPTELDGGSVKETAAEEESRVLAPGAAPFGNFPHYSRFHPPEQRLRLL
PPELLRQLFPESPENGPILGLDVGCNSGDLSVALYKHFLSLPDGETCSDA
SREFRLLCCDIDPVLVKRAEKECPFPDALTFITLDFMNQRTRKVLLSSFL
SQFGRSVFDIGFCMSITMWIHLNHGDHGLWEFLAHLSSLCHYLLVEPQPW
KCYRAAARRLRKLGLHDFDHFHSLAIRGDMPNQIVQILTQDHGMELICCF
GNTSWDRSLLLFRAKQTIETHPIPESLIEKGKEKNRLSFQKQ

Enzymatic activities

Reaction Substrate Type Position
(pN):m(pN) pre-miRNA () pre-miR-145/ /cytosolic 0
(pN):m(pN) pre-miRNA () pre-miR-23b/ /cytosolic 0
m(pN):mm(pN) pre-miRNA () pre-miR-145/ /cytosolic 0
m(pN):mm(pN) pre-miRNA () pre-miR-23b/ /cytosolic 0

Publications

Title Authors Journal Details PubMed Id DOI
Human RNA Methyltransferase BCDIN3D Regulates MicroRNA Processing. Xhemalce B, Robson SC, Kouzarides T... Cell [details] 23063121 -

Links

_PubMed_

Last modification of this entry: 2012-11-27 14:24:39.369545
Edited by a user: magda
Edited content: Changed full_name and protein_sequence.