Protein Summary

WDR4 from Homo sapiens

Full name: tRNA (guanine-N(7)-)-methyltransferase subunit WDR4
Synonym:
GI: 16445428
Orf:
COG: COG2319
UniProt: P57081
Structures: | |
Complex: TRMB/WDR4

Comments:

Homolog of yeast Trm82. Required for the formation of m7G by TRMB (non-catalytic subunit of the complex).

Protein sequence:

MAGSVGLALCGQTLVVRGGSRFLATSIASSDDDSLFIYDCSAAEKKSQEN
KGEDAPLDQGSGAILASTFSKSGSYFALTDDSKRLILFRTKPWQCLSVRT
VARRCTALTFIASEEKVLVADKSGDVYSFSVLEPHGCGRLELGHLSMLLD
VAVSPDDRFILTADRDEKIRVSWAAAPHSIESFCLGHTEFVSRISVVPTQ
PGLLLSSSGDGTLRLWEYRSGRQLHCCHLASLQELVDPQAPQKFAASRIA
FWCQENCVALLCDGTPVVYIFQLDARRQQLVYRQQLAFQHQVWDVAFEET
QGLWVLQDCQEAPLVLYRPVGDQWQSVPESTVLKKVSGVLRGNWAMLEGS
AGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHA
KKMRPGEATLSC

Publications

Title Authors Journal Details PubMed Id DOI
Two proteins that form a complex are required for 7-methylguanosine modification of yeast tRNA. Alexandrov A, Martzen MR, Phizicky EM RNA [details] 12403464 -
Mutation in WDR4 impairs tRNA m(7)G46 methylation and causes a distinct form of microcephalic primordial dwarfism. Shaheen R, Abdel-Salam GM, Guy MP, Alomar R, Abdel-Hamid MS, Afifi HH, Ismail SI, Emam BA, Phizicky EM, Alkuraya FS... Genome Biol [details] 26416026 -

Links

_PubMed_

Last modification of this entry: 2015-10-07 10:43:20.227229
Edited by a user: magda
Edited content: Changed protein_sequence and papers.