Protein Summary

METTL1 from Homo sapiens

Full name: tRNA (guanine-N(7)-)-methyltransferase
Synonym: TRMB
GI: 167004078
Orf: C12orf1
COG: COG0220
UniProt: Q9UBP6
Structures: | 3CKK |
Complex: TRMB/WDR4
Enzyme type: methyltransferase
Position of modification - modification: t:46 - m7G

Comments:

Homolog of yeast Trm8. Requires WDR4 protein for acitivity. The activity was assayed on yeast tRNAPhe. .

Protein sequence:

MAAETRNVAGAEAPPPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELY
PEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPD
TLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFY
KGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDV
LELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGK
NFPAIFRRIQDPVLQAVTSQTSLPGH

Enzymatic activities

Reaction Substrate Type Position
G:m7G tRNA (t) Phe/#AA/unknown 46

Publications

Title Authors Journal Details PubMed Id DOI
Two proteins that form a complex are required for 7-methylguanosine modification of yeast tRNA. Alexandrov A, Martzen MR, Phizicky EM RNA [details] 12403464 -

Links

_PubMed_

Last modification of this entry: 2019-01-16 10:51:24.286844
Edited by a user: boccaletto
Edited content: Changed acronym, synonym and protein_sequence.