Protein Summary

TrmI from Pyrococcus abyssi

Full name: tRNA (adenine(57)-N(1)/adenine(58)-N(1))-methyltransferase TrmI
Synonym: pimT-like
GI: 5457862
Orf: PAB0283
COG: COG2519
UniProt: Q9V1J7
Structures: | 3LGA | 3LHD | 3MB5 |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:58 - m1A
t:57 - m1I

Comments:



Protein sequence:

MIREGDKVVLVDPRGKRYLITVSKRDFHTDLGILKLEEIIGRNFGEAIKS
HKGHEFKILRPRIVDYLDKMKRGPQIVHPKDAALIVAYAGISPGDFIVEA
GVGSGALTLFLANIVGPEGRVVSYEIREDFAKLAWENIKWAGFDDRVTIK
LKDIYEGIEEENVDHVILDLPQPERVVEHAAKALKPGGFFVAYTPCSNQV
MRLHEKLREFKDYFMKPRTINVLVFDQEVKKECMRPRTTALVHTGYITFA
RRI

Enzymatic activities

Reaction Substrate Type Position
A:m1A tRNA (t)   58
A:m1A tRNA (t) 57

Publications

Title Authors Journal Details PubMed Id DOI
A primordial RNA modification enzyme: the case of tRNA (m1A) methyltransferase. Roovers M, Wouters J, Bujnicki JM, Tricot C, Stalon V, Grosjean H, Droogmans L Nucleic Acids Res [details] 14739239 -
Structural comparison of tRNA m(1)A58 methyltransferases revealed different molecular strategies to maintain their oligomeric architecture under extreme conditions. Guelorget A, Barraud P, Tisne C, Golinelli-Pimpaneau B BMC Struct Biol [details] 22168821 -
Dynamics of RNA modification by a multi-site-specific tRNA methyltransferase. Hamdane D, Guelorget A, Guerineau V, Golinelli-Pimpaneau B... Nucleic Acids Res [details] 25217588 -
Insights into the hyperthermostability and unusual region-specificity of archaeal Pyrococcus abyssi tRNA m1A57/58 methyltransferase. Guelorget A, Roovers M, Guerineau V, Barbey C, Li X, Golinelli-Pimpaneau B... Nucleic Acids Res [details] 20483913 -

Last modification of this entry: 2014-12-24 12:34:09.315093
Edited by a user: magda
Edited content: No fields changed.