Protein Summary

METTL3 from Homo sapiens

Full name: N6-adenosine-methyltransferase 70 kDa subunit
Synonym: MTA70
GI: 21361827
Orf:
COG: COG4725
UniProt: Q86U44
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: m:many - m6A

Comments:

Forms a stable heterodimer with METTL14. The complex catalyses the AdoMet dependent N6-methylation of internal adenosine in mammalian mRNA. METTL3 displays a regulatory role on several cellular functions. METTL3 is critical for viability of mammalian cells. Notice, the methyl group of m6A in mRNA can be removed by the obesity-associated protein FTO (demethylase enzyme.)

Protein sequence:

MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDS
PVPTAPTSGGPKPSTASAVPELATDPELEKKLLHHLSDLALTLPTDAVSI
CLAISTPDAPATQDGVESLLQKFAAQELIEVKRGLLQDDAHPTLVTYADH
SKLSAMMGAVAEKKGPGEVAGTVTGQKRRAEQDSTTVAAFASSLVSGLNS
SASEPAKEPAKKSRKHAASDVDLEIESLLNQQSTKEQQSKKVSQEILELL
NTTTAKEQSIVEKFRSRGRAQVQEFCDYGTKEECMKASDADRPCRKLHFR
RIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACMDSEAPGSKDHTPS
QELALTQSVGGDSSADRLFPPQWICCDIRYLDVSILGKFAVVMADPPWDI
HMELPYGTLTDDEMRRLNIPVLQDDGFLFLWVTGRAMELGRECLNLWGYE
RVDEIIWVKTNQLQRIIRTGRTGHWLNHGKEHCLVGVKGNPQGFNQGLDC
DVIVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNVQPNWITLGNQ
LDGIHLLDPDVVARFKQRYPDGIISKPKNL

Enzymatic activities

Reaction Substrate Type Position
A:m6A mRNA (m) many

Publications

Title Authors Journal Details PubMed Id DOI
Structure prediction and phylogenetic analysis of a functionally diverse family of proteins homologous to the MT-A70 subunit of the human mRNA:m(6)A methyltransferase. Bujnicki JM, Feder M, Radlinska M, Blumenthal RM J Mol Evol [details] 12355263 -
N6-adenosine methylation in mRNA: substrate specificity and enzyme complexity. Rottman FM, Bokar JA, Narayan P, Shambaugh ME, Ludwiczak R... Biochimie [details] 7748945 -
Expression of the mRNA (N6-adenosine)-methyltransferase S-adenosyl-L-methionine binding subunit mRNA in cultured cells. Leach RA, Tuck MT... Int J Biochem Cell Biol [details] 11470232 -
Purification and cDNA cloning of the AdoMet-binding subunit of the human mRNA (N6-adenosine)-methyltransferase. Bokar JA, Shambaugh ME, Polayes D, Matera AG, Rottman FM... RNA [details] 9409616 -
A METTL3-METTL14 complex mediates mammalian nuclear RNA N-adenosine methylation. Liu J, Yue Y, Han D, Wang X, Fu Y, Zhang L, Jia G, Yu M, Lu Z, Deng X, Dai Q, Chen W, He C... Nat Chem Biol [details] 24316715 -
Molecular biology. Internal mRNA methylation finally finds functions. Nilsen TW... Science [details] 24626918 -

Links

_PubMed_

Last modification of this entry: 2014-03-18 13:31:05.873102
Edited by a user: magda
Edited content: Changed papers.