Protein Summary

Dus2 from Homo sapiens

Full name: tRNA-dihydrouridine(20) synthase [NAD(P)+]-like
Synonym: DUS2L
GI: 8923374
Orf:
COG: COG0042
UniProt: Q9NX74
Structures: | 4WFS | 4WFT |
Complex:
Enzyme type: dihydrouridine synthase
Position of modification - modification:

Comments:

hDUS2 shows 39% similarity to S. cerevisiae DUS2 and catalyzes the same D-formation in the D-loop of tRNA through reduction of uracil base with flavin mononucleotide (FMN) as a cofactor. This human Dus enzyme was shown to interact with a few tRNA synthetases (specific for Glu-Pro). hDus2 plays a role in pulmonary carcinogenesis.

Protein sequence:

MILNSLSLCYHNKLILAPMVRVGTLPMRLLALDYGADIVYCEELIDLKMI
QCKRVVNEVLSTVDFVAPDDRVVFRTCEREQNRVVFQMGTSDAERALAVA
RLVENDVAGIDVNMGCPKQYSTKGGMGAALLSDPDKIEKILSTLVKGTRR
PVTCKIRILPSLEDTLSLVKRIERTGIAAIAVHGRKREERPQHPVSCEVI
KAIADTLSIPVIANGGSHDHIQQYSDIEDFRQATAASSVMVARAAMWNPS
IFLKEGLRPLEEVMQKYIRYAVQYDNHYTNTKYCLCQMLREQLESPQGRL
LHAAQSSREICEAFGLGAFYEETTQELDAQQARLSAKTSEQTGEPAEDTS
GVIKMAVKFDRRAYPAQITPKMCLLEWCRREKLAQPVYETVQRPLDRLFS
SIVTVAEQKYQSTLWDKSKKLAEQAAAIVCLRSQGLPEGRLGEESPSLHK
RKREAPDQDPGGPRAQELAQPGDLCKKPFVALGSGEESPLEGW

Publications

Title Authors Journal Details PubMed Id DOI
A novel human tRNA-dihydrouridine synthase involved in pulmonary carcinogenesis. Kato T, Daigo Y, Hayama S, Ishikawa N, Yamabuki T, Ito T, Miyamoto M, Kondo S, Nakamura Y Cancer Res [details] 15994936 -
An extended dsRBD is required for post-transcriptional modification in human tRNAs. Bou-Nader C, Pecqueur L, Bregeon D, Kamah A, Guerineau V, Golinelli-Pimpaneau B, Guimaraes BG, Fontecave M, Hamdane D... Nucleic Acids Res [details] 26429968 -

Links

_PubMed_

Last modification of this entry: 2015-10-07 10:28:21.810162
Edited by a user: magda
Edited content: Changed papers.