Protein Summary

Nsr from Streptomyces actuosus

Full name: rRNA (adenosine-2'-O-)-methyltransferase
Synonym: Nosiheptide-resistance methyltransferase
GI: 1654413
Orf: nsh
COG:
UniProt: P72385
Structures: | 3NK6 | 3NK7 |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: l:1067(1067) - Am

Comments:

Methylation site was determined for E. coli rRNA.

Protein sequence:

MTARQHTDVLPRPSPATALMASLLPARAVAAEAFGDGHDEDWFGQLLPAE
ARLMAGAGEKRRRDFAGVRVCARRALRTLGHAPVPLLPGPRGEPRWPDGV
VGSLTHCAGYRAAVVARPGPGLAGVGIDAEPHAPLDADVLEMVASPAERA
HLALLARTRPGVHWGRLLFCVKEAVFKAWYPAARCELGFLEADVRFTADG
PHSADGPHSADGRYGTDGMHGIVTATLTRAGPFAAVSGRWRVAGGVIATA
VVI

Enzymatic activities

Reaction Substrate Type Position
A:Am rRNA (r) LSU/23S/prokaryotic cytosol 1067

Publications

Title Authors Journal Details PubMed Id DOI
Crystallization and preliminary crystallographic analysis of nosiheptide-resistance methyltransferase from Streptomyces actuosus in complex with SAM. Yang H, Wang P, Dong Z, Li X, Gong R, Yang Y, Li Z, Xu Y, Xu Y Acta Crystallogr Sect F Struct Biol Cryst Commun [details] 20445264 -

Last modification of this entry: 2013-02-15 11:51:09.349315
Edited by a user: magda
Edited content: Changed protein_sequence and comments.