Protein Summary

Sgm from Micromonospora zionensis

Full name: rRNA adenine N-7-methyltransferase
Synonym: Sisomicin-gentamicin resistance methylase
GI: 75383291
Orf: sgm
COG: COG2263
UniProt: Q7M0R2
Structures: | 3LCU | 3LCV |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: s:1405(1405) - m7G

Comments:

Methylation site was determined for E. coli rRNA.

Protein sequence:

MTAPAADDRIDEIERAITKSRRYQTVAPATVRRLARAALVAARGDVPDAV
KRTKRGLHEIYGAFLPPSPPNYAALLRHLDSAVDAGDDEAVRAALLRAMS
VHISTRERLPHLDEFYRELFRHLPRPNTLRDLACGLNPLAAPWMGLPAET
VYIASDIDARLVGFVDEALTRLNVPHRTNVADLLEDRLDEPADVTLLLKT
LPCLETQQRGSGWEVIDIVNSPNIVVTFPTKSLGQRSKGMFQNYSQSFES
QARERSCRIQRLEIGNELIYVIQK

Enzymatic activities

Reaction Substrate Type Position
G:m7G rRNA (r) SSU/16S/prokaryotic cytosol 1405

Publications

Title Authors Journal Details PubMed Id DOI
Structural basis for the methylation of G1405 in 16S rRNA by aminoglycoside resistance methyltransferase Sgm from an antibiotic producer: a diversity of active sites in m7G methyltransferases. Husain N, Tkaczuk KL, Tulsidas SR, Kaminska KH, Cubrilo S, Maravic-Vlahovicek G, Bujnicki JM, Sivaraman J Nucleic Acids Res [details] 20194115 -
Cloning and characterization of an aminoglycoside resistance determinant from Micromonospora zionensis. Kojic M, Topisirovic L, Vasiljevic B J Bacteriol [details] 1447159 -
Critical residues for cofactor binding and catalytic activity in the aminoglycoside resistance methyltransferase Sgm. Savic M, Ilic-Tomic T, Macmaster R, Vasiljevic B, Conn GL J Bacteriol [details] 18586937 -

Last modification of this entry: 2013-02-15 12:08:32.092663
Edited by a user: magda
Edited content: Changed protein_sequence and comments.