Protein Summary

Tsr from Streptomyces cyaneus

Full name: rRNA (adenosine-2'-O-)-methyltransferase
Synonym: Thiostrepton Resistance 23S rRNA methyltransferase
GI: 136456
Orf: tsr
COG: COG0566
UniProt: P18644
Structures: | 3GYQ |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: l:1067(1067) - Am

Comments:

Methylation site was determined for E. coli rRNA.

Protein sequence:

MTELDTIANPSDPAVQRIIDVTKPSRSNIKTTLIEDVEPLMHSIAAGVEF
IEVYGSDSSPFPSELLDLCGRQNIPVRLIDSSIVNQLFKGERKAKTFGIA
RVPRPARFGDIASRRGDVVVLDGVKIVGNIGAIVRTSLALGASGIILVDS
DITSIADRRLQRASRGYVFSLPVVLSGREEAIAFIRDSGMQLMTLKADGD
ISVKELGDNPDRLALLFGSEKGGPSDLFEEASSASVSIPMMSQTESLNVS
VSLGIALHERIDRNLAANR

Enzymatic activities

Reaction Substrate Type Position
A:Am rRNA (r) LSU/23S/prokaryotic cytosol 1067

Publications

Title Authors Journal Details PubMed Id DOI
Nucleotide sequences encoding and promoting expression of three antibiotic resistance genes indigenous to Streptomyces. Bibb MJ, Bibb MJ, Ward JM, Cohen SN Mol Gen Genet [details] 2987648 -
Structure of the thiostrepton resistance methyltransferase.S-adenosyl-L-methionine complex and its interaction with ribosomal RNA. Dunstan MS, Hang PC, Zelinskaya NV, Honek JF, Conn GL J Biol Chem [details] 19369248 -
Overexpression of the thiostrepton-resistance gene from Streptomyces azureus in Escherichia coli and characterization of recognition sites of the 23S rRNA A1067 2'-methyltransferase in the guanosine triphosphatase center of 23S ribosomal RNA. Bechthold A, Floss HG Eur J Biochem [details] 7925357 -
Binding Induced RNA Conformational Changes Control Substrate Recognition and Catalysis by the Thiostrepton-resistance Methyltransferase (Tsr). Kuiper EG, Conn GL... J Biol Chem [details] 25086036 -

Last modification of this entry: 2014-08-14 13:53:48.659026
Edited by a user: magda
Edited content: Changed papers.