Protein Summary

ArmA from Escherichia coli

Full name: rRNA adenine N-7-methyltransferase
Synonym: aminoglycoside resistance 16S rRNA methyltransferase
GI: 124021052
Orf: armA
COG: COG2813
UniProt: Q6F5A0
Structures: | 3FZG |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: s:1405(1405) - m7G

Comments:



Protein sequence:

MDKNDVVKKILESKKYENLDSDIVEKVVSISEKKYKLKEVENYSKKKLHQ
IWGSYYSAYPNWDKLLKKYNQGQLSIEDLLKIHSSTNERVATLNDFYTYV
FGNIKHVSSILDFGCGFNPLALYQWNENEKIIYHAYDIDRAEIAFLSSII
GKLKTTIKYRFLNKESDVYKGTYDVVFLLKMLPVLKQQDVNILDFLQLFH
TQNFVISFPIKSLSGKEKGMEENYQLWFESFTKGWIKILDSKVIGNELVY
ITSGFQK

Enzymatic activities

Reaction Substrate Type Position
G:m7G rRNA (r) SSU/16S/prokaryotic cytosol 1405

Publications

Title Authors Journal Details PubMed Id DOI
Structural bases for 16 S rRNA methylation catalyzed by ArmA and RmtB methyltransferases. Schmitt E, Galimand M, Panvert M, Courvalin P, Mechulam Y J Mol Biol [details] 19303884 -
Plasmid-mediated 16S rRNA methylases among extended-spectrum beta-lactamase-producing Enterobacteriaceae isolates. Bercot B, Poirel L, Nordmann P Antimicrob Agents Chemother [details] 18838598 -

Last modification of this entry: Feb. 4, 2014