Protein Summary

ErmAM from Streptococcus pneumoniae

Full name: rRNA adenine N-6-methyltransferase
Synonym: macrolide-lincosamide-streptogramin B resistance 23S rRNA methyltransferase
GI: 127202
Orf: ermAM
COG: COG0030
UniProt: P21236
Structures: | 1YUB |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: l:2085(2085) - m6A

Comments:

ErmAM methylates the exocyclic amine of A2085 in helix 75 of 23S rRNA. It is responsible for the development of bacterial resistance to lincosamide/ Streptogramin-type of antibiotics.

Protein sequence:

MNKNIKYSQNFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTTKLAKI
SKQVTSIELDSHLFNLSSEKLKLNIRVTLIHQDILQFQFPNKQRYKIVGS
IPYHLSTQIIKKVVFESHASDIYLIVEEGFYKRTLDIHRTLGLLLHTQVS
IQQLLKLPAECFHPKPKVNSVLIKLTRHTTDVPDKYWKLYTYFVSKWVNR
EYRQLFTKNQFHQAMKHAKVNNLSTITYEQVLSIFNSYLLFNGRK

Enzymatic activities

Reaction Substrate Type Position
A:m6A rRNA (r) LSU/23S/prokaryotic cytosol 2085

Publications

Title Authors Journal Details PubMed Id DOI
Nucleotide sequence of the erythromycin resistance gene of the conjugative transposon Tn1545. Trieu-Cuot P, Poyart-Salmeron C, Carlier C, Courvalin P Nucleic Acids Res [details] 2163525 -
Solution structure of an rRNA methyltransferase (ErmAM) that confers macrolide-lincosamide-streptogramin antibiotic resistance. Yu L, Petros AM, Schnuchel A, Zhong P, Severin JM, Walter K, Holzman TF, Fesik SW Nat Struct Biol [details] 9187657 -

Links

_PubMed_
_Wikipedia_

Last modification of this entry: 2012-08-31 16:27:53.959061
Edited by a user: magda
Edited content: Changed protein_sequence, additional_information and comments.