Protein Summary

ErmC' from Bacillus subtilis

Full name: rRNA adenine N-6-methyltransferase
Synonym: macrolide-lincosamide-streptogramin B resistance 23S rRNA methyltransferase
GI: 127198
Orf: ermC'
COG: COG0030
UniProt: P13956
Structures: | 1QAM | 1QAN | 1QAO | 1QAQ |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: l:2085(2058) - m6A

Comments:

ErmC' methylates the exocyclic amine of A2058 (E. coli numbering) in helix 75 of 23S rRNA. It is responsible for the development of bacterial resistance to lincosamide/streptogramin-type of antibiotics.

Protein sequence:

MNEKNIKHSQNFITSKHNIDKIMTNIRLNEHDNIFEIGSGKGHFTLELVQ
RCNFVTAIEIDHKLCKTTENKLVDHDNFQVLNKDILQFKFPKNQSYKIFG
NIPYNISTDIIRKIVFDSIADEIYLIVEYGFAKRLLNTKRSLALFLMAEV
DISILSMVPREYFHPKPKVNSSLIRLNRKKSRISHKDKQKYNYFVMKWVN
KEYKKIFTKNQFNNSLKHAGIDDLNNISFEQFLSLFNSYKLFNK

Enzymatic activities

Reaction Substrate Type Position
A:m6A rRNA (r) LSU/23S/prokaryotic cytosol 2085

Publications

Title Authors Journal Details PubMed Id DOI
Sequence and properties of pIM13, a macrolide-lincosamide-streptogramin B resistance plasmid from Bacillus subtilis. Monod M, Denoya C, Dubnau D J Bacteriol [details] 3087948 -
Substrate requirements for ErmC' methyltransferase activity. Zhong P, Pratt SD, Edalji RP, Walter KA, Holzman TF, Shivakumar AG, Katz L J Bacteriol [details] 7543473 -
Family background of children with Down's syndrome and of children with a similar degree of mental retardation. Gath A, Gumley D Br J Psychiatry [details] 2946350 -
Alanine-scanning mutagenesis of the predicted rRNA-binding domain of ErmC' redefines the substrate-binding site and suggests a model for protein-RNA interactions. Maravic G, Bujnicki JM, Feder M, Pongor S, Flogel M Nucleic Acids Res [details] 12907737 -
Crystal structure of ErmC', an rRNA methyltransferase which mediates antibiotic resistance in bacteria. Bussiere DE, Muchmore SW, Dealwis CG, Schluckebier G, Nienaber VL, Edalji RP, Walter KA, Ladror US, Holzman TF, Abad-Zapatero C Biochemistry [details] 9585521 -
The 2.2 A structure of the rRNA methyltransferase ErmC' and its complexes with cofactor and cofactor analogs: implications for the reaction mechanism. Schluckebier G, Zhong P, Stewart KD, Kavanaugh TJ, Abad-Zapatero C J Mol Biol [details] 10366505 -

Links

_PubMed_
_Wikipedia_

Last modification of this entry: 2012-08-31 16:40:16.480693
Edited by a user: magda
Edited content: Changed additional_information.