Protein Summary

AviRa from Streptomyces viridochromogenes

Full name: rRNA guanine N-1-methyltransferase
Synonym: avilamycin resistance 23S rRNA methyltransferase
GI: 28380397
Orf: aviRa
COG: COG1041
UniProt: Q9F5K5
Structures: | 1O9G | 1O9H |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: l:2535(2535) - m1G

Comments:

Methylation site was determined for E. coli rRNA.

Protein sequence:

MSAYRHAVERIDSSDLACGVVLHSAPGYPAFPVRLATEIFQRALARLPGD
GPVTLWDPCCGSGYLLTVLGLLHRRSLRQVIASDVDPAPLELAAKNLALL
SPAGLTARELERREQSERFGKPSYLEAAQAARRLRERLTAEGGALPCAIR
TADVFDPRALSAVLAGSAPDVVLTDLPYGERTHWEGQVPAQPVAGLLRSL
ASALPAHAVIAVTDRSRKIPVAPVKALERLKIGTRSAVLVRAADVLEAGP

Enzymatic activities

Reaction Substrate Type Position
G:m1G rRNA (r) LSU/23S/prokaryotic cytosol 2535

Publications

Title Authors Journal Details PubMed Id DOI
The avilamycin resistance determinants AviRa and AviRb methylate 23S rRNA at the guanosine 2535 base and the uridine 2479 ribose. Treede I, Jakobsen L, Kirpekar F, Vester B, Weitnauer G, Bechthold A, Douthwaite S Mol Microbiol [details] 12828631 -
Crystal structure of the avilamycin resistance-conferring methyltransferase AviRa from Streptomyces viridochromogenes. Mosbacher TG, Bechthold A, Schulz GE J Mol Biol [details] 12742024 -
An ATP-binding cassette transporter and two rRNA methyltransferases are involved in resistance to avilamycin in the producer organism Streptomyces viridochromogenes Tu57. Weitnauer G, Gaisser S, Trefzer A, Stockert S, Westrich L, Quiros LM, Mendez C, Salas JA, Bechthold A Antimicrob Agents Chemother [details] 11181344 -

Last modification of this entry: 2013-02-15 10:39:11.634996
Edited by a user: magda
Edited content: Changed protein_sequence and comments.