Protein Summary

DcpS from Homo sapiens

Full name: Scavenger mRNA-decapping enzyme DcpS
Synonym: DCS-1, Hint-related 7meGMP-directed hydrolase, HINT5
GI: 116241325
Orf: HSPC015
COG: COG5075
UniProt: Q96C86
Structures: | 1ST0 | 1ST4 | 1XML | 1XMM |
Complex:
Enzyme type: hydrolase
Position of modification - modification:

Comments:

DcpS, catalyzes residual cap hydrolysis following mRNA degradation, releasing N-7 methyl guanosine monophosphate and 5'-diphosphate terminated cap or mRNA products. Removes the 7-methyl guanine cap structure from mRNA fragments shorter than 10 nucleotides that are produced by 3'->5' exosome-mediated mRNA decay. Releases m7GMP. Can also degrade m7GDP to m7GMP. Has no activity towards mRNA molecules longer than 25 nucleotides.

Protein sequence:

MADAAPQLGKRKRELDVEEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQ
KVLRESARDKIIFLHGKVNEASGDGDGEDAVVILEKTPFQVEQVAQLLTG
SPELQLQFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHLQKYLRQDLRL
IRETGDDYRNITLPHLESQSLSIQWVYNILDKKAEADRIVFENPDPSDGF
VLIPDLKWNQQQLDDLYLIAICHRRGIRSLRDLTPEHLPLLRNILHQGQE
AILQRYRMKGDHLRVYLHYLPSYYHLHVHFTALGFEAPGSGVERAHLLAE
VIENLECDPRHYQQRTLTFALRADDPLLKLLQEAQQS

Publications

Title Authors Journal Details PubMed Id DOI
Insights into the structure, mechanism, and regulation of scavenger mRNA decapping activity. Gu M, Fabrega C, Liu SW, Liu H, Kiledjian M, Lima CD Mol Cell [details] 15068804 -
The scavenger mRNA decapping enzyme DcpS is a member of the HIT family of pyrophosphatases. Liu H, Rodgers ND, Jiao X, Kiledjian M EMBO J [details] 12198172 -
Coordinate expression of NADPH-dependent flavin reductase, Fre-1, and Hint-related 7meGMP-directed hydrolase, DCS-1. Kwasnicka DA, Krakowiak A, Thacker C, Brenner C, Vincent SR J Biol Chem [details] 12871939 -
Functional link between the mammalian exosome and mRNA decapping. Wang Z, Kiledjian M Cell [details] 11747811 -
DcpS can act in the 5'-3' mRNA decay pathway in addition to the 3'-5' pathway. van Dijk E, Le Hir H, Seraphin B Proc Natl Acad Sci U S A [details] 14523240 -
Functional analysis of mRNA scavenger decapping enzymes. Liu SW, Jiao X, Liu H, Gu M, Lima CD, Kiledjian M RNA [details] 15273322 -

Links

_PubMed_

Last modification of this entry: 2013-06-18 10:54:16.766918
Edited by a user: magda
Edited content: Changed position.